StarFunc result for job id Q01118

User Input

>input (1682 residues)
MLASPEPKGLVPFTKESFELIKQHIAKTHNEDHEEEDLKPTPDLEVGKKLPFIYGNLSQG
MVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCTLSPFNCIRRTTIKVLVHPFF
QLFILISVLIDCVFMSLTNLPKWRPVLENTLLGIYTFEILVKLFARGVWAGSFSFLGDPW
NWLDFSVTVFEVIIRYSPLDFIPTLQTARTLRILKIIPLNQGLKSLVGVLIHCLKQLIGV
IILTLFFLSIFSLIGMGLFMGNLKHKCFRWPQENENETLHNRTGNPYYIRETENFYYLEG
ERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLMAQDYPEVLYH
QILYASGKVYMIFFVVVSFLFSFYMASLFLGILAMAYEEEKQRVGEISKKIEPKFQQTGK
ELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWYKFAK
TFLIWNCSPCWLKLKEFVHRIIMAPFTDLFLIICIILNVCFLTLEHYPMSKQTNTLLNIG
NLVFIGIFTAEMIFKIIAMHPYGYFQVGWNIFDSMIVFHGLIELCLANVAGMALLRLFRM
LRIFKLGKYWPTFQILMWSLSNSWVALKDLVLLLFTFIFFSAAFGMKLFGKNYEEFVCHI
DKDCQLPRWHMHDFFHSFLNVFRILCGEWVETLWDCMEVAGQSWCIPFYLMVILIGNLLV
LYLFLALVSSFSSCKDVTAEENNEAKNLQLAVARIKKGINYVLLKILCKTQNVPKDTMDH
VNEVYVKEDISDHTLSELSNTQDFLKDKEKSSGTEKNATENESQSLIPSPSVSETVPIAS
GESDIENLDNKEIQSKSGDGGSKEKIKQSSSSECSTVDIAISEEEEMFYGGERSKHLKNG
CRRGSSLGQISGASKKGKIWQNIRKTCCKIVENNWFKCFIGLVTLLSTGTLAFEDIYMDQ
RKTIKILLEYADMIFTYIFILEMLLKWMAYGFKAYFSNGWYRLDFVVVIVFCLSLIGKTR
EELKPLISMKFLRPLRVLSQFERMKVVVRALIKTTLPTLNVFLVCLMIWLIFSIMGVDLF
AGRFYECIDPTSGERFPSSEVMNKSRCESLLFNESMLWENAKMNFDNVGNGFLSLLQVAT
FNGWITIMNSAIDSVAVNIQPHFEVNIYMYCYFINFIIFGVFLPLSMLITVIIDNFNKHK
IKLGGSNIFITVKQRKQYRRLKKLMYEDSQRPVPRPLNKLQGFIFDVVTSQAFNVIVMVL
ICFQAIAMMIDTDVQSLQMSIALYWINSIFVMLYTMECILKLIAFRCFYFTIAWNIFDFM
VVIFSITGLCLPMTVGSYLVPPSLVQLILLSRIIHMLRLGKGPKVFHNLMLPLMLSLPAL
LNIILLIFLVMFIYAVFGMYNFAYVKKEAGINDVSNFETFGNSMLCLFQVAIFAGWDGML
DAIFNSKWSDCDPDKINPGTQVRGDCGNPSVGIFYFVSYILISWLIIVNMYIVVVMEFLN
IASKKKNKTLSEDDFRKFFQVWKRFDPDRTQYIDSSKLSDFAAALDPPLFMAKPNKGQLI
ALDLPMAVGDRIHCLDILLAFTKRVMGQDVRMEKVVSEIESGFLLANPFKITCEPITTTL
KRKQEAVSATIIQRAYKNYRLRRNDKNTSDIHMIDGDRDVHATKEGAYFDKAKEKSPIQS
QI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7tj9A	0.648	0.977	0.000	1111	0.658	0.995	7tj9A.pdb.gz	Structure-guided unlocking of Na X reveals a non-selective tetrodotoxin-sensitive cation channel.
2	PDB:7w9lA	0.738	0.869	0.000	1420	0.490	0.580	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
3	PDB:7xveA	0.677	0.878	0.000	1276	0.437	0.576	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
4	AFDB:A0A0G2KYI1	0.844	0.730	0.000	1954	0.486	0.419	A0A0G2KYI1.pdb.gz
5	AFDB:A0A0R4IUM7	0.840	0.727	0.000	1955	0.490	0.422	A0A0R4IUM7.pdb.gz	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
6	AFDB:A2APX8	0.843	0.710	0.000	2009	0.525	0.440	A2APX8.pdb.gz	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
7	AFDB:B1AWN6	0.843	0.712	0.000	2006	0.540	0.453	B1AWN6.pdb.gz	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
8	AFDB:B1AYL1	0.892	0.893	0.000	1681	0.741	0.742	B1AYL1.pdb.gz	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
9	AFDB:F1LQQ7	0.904	0.893	0.000	1704	0.735	0.725	F1LQQ7.pdb.gz	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
10	AFDB:F1QXF5	0.854	0.725	0.000	1996	0.519	0.437	F1QXF5.pdb.gz	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
11	AFDB:F1R3Q5	0.840	0.736	0.000	1932	0.483	0.420	F1R3Q5.pdb.gz
12	AFDB:P08104	0.852	0.738	0.000	1951	0.525	0.453	P08104.pdb.gz	SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn3a PE=1 SV=1
13	AFDB:P35500	0.803	0.642	0.000	2131	0.389	0.307	P35500.pdb.gz	SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster OX=7227 GN=para PE=2 SV=3
14	PDB:6j8gA	0.644	0.942	2.122E-90	1140	0.392	0.579	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
15	PDB:6j8eA	0.648	0.950	7.772E-90	1139	0.387	0.572	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.
16	PDB:6agfA	0.650	0.954	7.968E-88	1138	0.381	0.563	6agfA.pdb.gz	Structure of the human voltage-gated sodium channel Nav1.4 in complex with beta 1.
17	PDB:7we4A	0.631	0.936	9.130E-84	1122	0.339	0.509	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
18	PDB:6lqaB	0.649	0.941	1.103E-80	1151	0.366	0.534	6lqaB.pdb.gz	Structural Basis for Pore Blockade of the Human Cardiac Sodium Channel Na v 1.5 by the Antiarrhythmic Drug Quinidine*.
19	PDB:6uz3A	0.640	0.948	1.984E-78	1126	0.359	0.536	6uz3A.pdb.gz	Structure of the Cardiac Sodium Channel.
20	PDB:7mixA	0.625	0.783	8.436E-52	1326	0.192	0.244	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT39	1136	1962	0.357	0.306	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
2	A0A0R4IUM7	1197	1955	0.361	0.311	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
3	A0A1B0GVX7	886	1618	0.284	0.295	A0A1B0GVX7_HUMAN Sodium voltage-gated channel alpha subunit 1 OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
4	A0A1W2PPJ3	1291	1998	0.400	0.337	A0A1W2PPJ3_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
5	A0A286YEQ8	623	1915	0.178	0.156	A0A286YEQ8_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
6	A0A286YF26	1291	1997	0.400	0.337	A0A286YF26_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
7	A0A590UK43	1221	1939	0.375	0.325	A0A590UK43_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
8	A0A8I6GH51	2404	1672	0.714	0.718	A0A8I6GH51_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=3 SV=1
9	A2APX8	1296	2009	0.398	0.333	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
10	A2ASI5	1294	1947	0.407	0.351	SCN3A_MOUSE Sodium channel protein type 3 subunit alpha OS=Mus musculus OX=10090 GN=Scn3a PE=1 SV=1
11	B1AWN6	1339	2006	0.410	0.343	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
12	B1AYL1	2560	1681	0.741	0.742	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
13	E9PG18	798	1998	0.243	0.204	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
14	E9PHB6	773	1983	0.243	0.206	E9PHB6_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
15	F1LQQ7	2522	1680	0.735	0.736	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
16	F1QXF5	1272	1996	0.391	0.329	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
17	H9KVD2	831	2016	0.249	0.207	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
18	K4DIA1	1136	1962	0.357	0.306	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
19	O08562	1373	1984	0.424	0.359	SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn9a PE=1 SV=1
20	O88420	1251	1978	0.381	0.324	SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn8a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16905 GPHH	1.4e+02	13.8	Voltage-dependent L-type calcium channel, IQ-associated
2	PF00520 Ion_trans	1.6e-183	618.8	Ion transport protein
3	PF00612 IQ	2.7e+02	12.8	IQ calmodulin-binding motif
4	PF06512 Na_trans_assoc	4.6e-18	77.8	Sodium ion transport-associated

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386796

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396915	0.916	Sodium channel subunit beta-1
2	9606.ENSP00000322460	0.894	Sodium channel subunit beta-4
3	9606.ENSP00000410257	0.813	Sodium channel protein type 5 subunit alpha
4	9606.ENSP00000376523	0.770	Sodium channel subunit beta-3
5	9606.ENSP00000278947	0.748	Sodium channel subunit beta-2
6	9606.ENSP00000357901	0.731	Sodium channel modifier 1
7	9606.ENSP00000280772	0.714	Ankyrin-3
8	9606.ENSP00000263373	0.651	Spectrin beta chain, non-erythrocytic 4
9	9606.ENSP00000339740	0.643	Calcium/calmodulin-dependent protein kinase type II subunit delta
10	9606.ENSP00000349588	0.638	Ankyrin-2
11	9606.ENSP00000345751	0.630	Amiloride-sensitive sodium channel subunit beta
12	9606.ENSP00000379098	0.629	Calcium/calmodulin-dependent protein kinase type II subunit beta
13	9606.ENSP00000381412	0.629	Calcium/calmodulin-dependent protein kinase type II subunit alpha
14	9606.ENSP00000352035	0.619	Potassium voltage-gated channel subfamily KQT member 2
15	9606.ENSP00000265709	0.616	Ankyrin-1
16	9606.ENSP00000344786	0.614	Neurofascin
17	9606.ENSP00000353292	0.614	Amiloride-sensitive sodium channel subunit alpha
18	9606.ENSP00000334198	0.612	Voltage-dependent T-type calcium channel subunit alpha-1H
19	9606.ENSP00000317790	0.610	Spectrin beta, non-erythrocytic 5
20	9606.ENSP00000349259	0.610	Spectrin beta chain, non-erythrocytic 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005248	0.999	voltage-gated sodium channel activity
GO:0005488	0.957	binding
GO:0005515	0.941	protein binding
GO:0022839	0.380	monoatomic ion gated channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.997	transport
GO:0006812	0.994	monoatomic cation transport
GO:0030001	0.979	metal ion transport
GO:0006814	0.971	sodium ion transport
GO:0032501	0.947	multicellular organismal process
GO:0009987	0.671	cellular process
GO:0003008	0.637	system process
GO:0006936	0.595	muscle contraction
GO:0065007	0.496	biological regulation
GO:0055085	0.409	transmembrane transport
GO:0050896	0.304	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0120025	0.967	plasma membrane bounded cell projection
GO:0032991	0.927	protein-containing complex
GO:0005622	0.756	intracellular anatomical structure
GO:0097386	0.749	glial cell projection
GO:0043227	0.676	membrane-bounded organelle
GO:0098796	0.411	membrane protein complex
GO:0005576	0.340	extracellular region
GO:1902495	0.335	transmembrane transporter complex
GO:0034703	0.300	cation channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]