StarFunc result for job id Q01167

User Input

>input (660 residues)
MAAAAAALSGAGTPPAGGGAGGGGAGGGGSPPGGWAVARLEGREFEYLMKKRSVTIGRNS
SQGSVDVSMGHSSFISRRHLEIFTPPGGGGHGGAAPELPPAQPRPDAGGDFYLRCLGKNG
VFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSSEKREKQEASESPVKAVQPHIS
PLTINIPDTMAHLISPLPSPTGTISAANSCPSSPRGAGSSGYKVGRVMPSDLNLMADNSQ
PENEKEASGGDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADK
GWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPRGVPCFRT
PLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGAAQPKLAVIQEAR
FAQSAPGSPLSSQPVLITVQRQLPQAIKPVTYTVATPVTTSTSQPPVVQTVHVVHQIPAV
SVTSVAGLAPANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG
TASRIIQTAQTTPVQTVTIVQQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASP
LHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01167	1.000	1.000	1.378E-97	660	1.000	1.000	Q01167.pdb.gz	FOXK2_HUMAN Forkhead box protein K2 OS=Homo sapiens OX=9606 GN=FOXK2 PE=1 SV=3
2	AFDB:P79772	0.147	0.242	3.603E-15	394	0.167	0.279	P79772.pdb.gz	FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus OX=9031 GN=FOXD3 PE=2 SV=1
3	AFDB:Q922I5	0.149	0.254	1.502E-14	372	0.159	0.282	Q922I5.pdb.gz	FOXI1_MOUSE Forkhead box protein I1 OS=Mus musculus OX=10090 GN=Foxi1 PE=2 SV=2
4	AFDB:B0UXI3	0.137	0.212	3.067E-14	422	0.159	0.249	B0UXI3.pdb.gz	B0UXI3_DANRE Forkhead box E3 OS=Danio rerio OX=7955 GN=foxe3 PE=2 SV=1
5	AFDB:B3DGC2	0.141	0.239	3.067E-14	383	0.156	0.269	B3DGC2.pdb.gz
6	AFDB:O73862	0.129	0.199	3.255E-14	420	0.150	0.236	O73862.pdb.gz	O73862_DANRE Forkhead box protein G1 OS=Danio rerio OX=7955 GN=BF-1 PE=2 SV=1
7	AFDB:Q7ZYQ0	0.145	0.249	5.901E-14	373	0.145	0.257	Q7ZYQ0.pdb.gz	FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis OX=8355 GN=foxi1e PE=2 SV=1
8	AFDB:B0R0B2	0.142	0.287	7.487E-14	321	0.141	0.290	B0R0B2.pdb.gz
9	AFDB:Q9PTK2	0.137	0.244	1.279E-13	365	0.141	0.255	Q9PTK2.pdb.gz	FOXE4_XENLA Forkhead box protein E4 OS=Xenopus laevis OX=8355 GN=foxe4 PE=2 SV=1
10	AFDB:Q91904	0.142	0.249	1.722E-13	370	0.130	0.232	Q91904.pdb.gz	FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis OX=8355 GN=foxi1-a PE=1 SV=1
11	PDB:2hdcA	0.125	0.656	1.003E-6	97	0.074	0.505	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:7dvqX	0.133	0.504	9.219E-5	156	0.036	0.154	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:2kb3A	0.122	0.497	9.382E-4	143	0.032	0.147	2kb3A.pdb.gz
14	PDB:6l9wD	0.102	0.430	1.916E-3	142	0.026	0.120	6l9wD.pdb.gz
15	PDB:5gm6U	0.135	0.463	3.473E-3	176	0.026	0.097	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:5z56X	0.121	0.439	4.225E-2	159	0.023	0.094	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
17	PDB:2nyxB	0.100	0.371	7.217E-2	147	0.018	0.082	2nyxB.pdb.gz
18	PDB:4etsB	0.090	0.344	7.659E-2	149	0.011	0.047	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
19	PDB:7dn3O	0.093	0.134	8.627E-2	443	0.020	0.029	7dn3O.pdb.gz	Structure of human RNA polymerase III elongation complex.
20	PDB:5k1yD	0.089	0.470	9.717E-2	92	0.015	0.109	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P42128	0.0	592	719	0.523	0.480	FOXK1_MOUSE Forkhead box protein K1 OS=Mus musculus OX=10090 GN=Foxk1 PE=1 SV=2
2	P85037	0.0	589	733	0.521	0.469	FOXK1_HUMAN Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1
3	Q01167	0.0	1332	660	1.000	1.000	FOXK2_HUMAN Forkhead box protein K2 OS=Homo sapiens OX=9606 GN=FOXK2 PE=1 SV=3
4	Q3UCQ1	0.0	1138	651	0.892	0.905	FOXK2_MOUSE Forkhead box protein K2 OS=Mus musculus OX=10090 GN=Foxk2 PE=1 SV=3
5	M9PI07	1.08e-55	204	745	0.189	0.168	M9PI07_DROME Forkhead box K, isoform O OS=Drosophila melanogaster OX=7227 GN=FoxK PE=1 SV=1
6	M9PC64	4.89e-55	202	745	0.192	0.170	M9PC64_DROME Forkhead box K, isoform P OS=Drosophila melanogaster OX=7227 GN=FoxK PE=1 SV=1
7	M9PF47	5.70e-55	202	760	0.192	0.167	M9PF47_DROME Forkhead box K, isoform N OS=Drosophila melanogaster OX=7227 GN=FoxK PE=1 SV=1
8	Q8IQE9	5.96e-55	202	746	0.192	0.170	Q8IQE9_DROME Forkhead box K, isoform G OS=Drosophila melanogaster OX=7227 GN=FoxK PE=1 SV=2
9	A0JL24	7.31e-49	183	654	0.182	0.183	A0JL24_DROME Fork head transcription factor short isoform OS=Drosophila melanogaster OX=7227 GN=FoxK PE=2 SV=1
10	Q0E8F8	1.15e-48	184	740	0.182	0.162	Q0E8F8_DROME Fork head transcription factor long isoform OS=Drosophila melanogaster OX=7227 GN=FoxK PE=1 SV=1
11	Q568V0	1.69e-31	129	420	0.095	0.150	Q568V0_DANRE Forkhead box protein G1 OS=Danio rerio OX=7955 GN=foxg1 PE=2 SV=1
12	Q92949	2.02e-31	129	421	0.085	0.133	FOXJ1_HUMAN Forkhead box protein J1 OS=Homo sapiens OX=9606 GN=FOXJ1 PE=1 SV=3
13	Q63247	2.56e-31	129	421	0.085	0.133	FOXJ1_RAT Forkhead box protein J1 OS=Rattus norvegicus OX=10116 GN=Foxj1 PE=2 SV=1
14	Q61660	2.71e-31	129	421	0.085	0.133	FOXJ1_MOUSE Forkhead box protein J1 OS=Mus musculus OX=10090 GN=Foxj1 PE=1 SV=2
15	Q9YHC5	7.63e-31	127	436	0.083	0.126	FOXG1_XENLA Forkhead box protein G1 OS=Xenopus laevis OX=8355 GN=foxg1 PE=2 SV=1
16	Q60987	8.34e-31	128	481	0.083	0.114	FOXG1_MOUSE Forkhead box protein G1 OS=Mus musculus OX=10090 GN=Foxg1 PE=1 SV=1
17	Q00939	8.40e-31	128	480	0.083	0.115	FOXG1_RAT Forkhead box protein G1 OS=Rattus norvegicus OX=10116 GN=Foxg1 PE=2 SV=1
18	O73862	8.46e-31	127	420	0.085	0.133	O73862_DANRE Forkhead box protein G1 OS=Danio rerio OX=7955 GN=BF-1 PE=2 SV=1
19	P55316	1.36e-30	128	489	0.083	0.112	FOXG1_HUMAN Forkhead box protein G1 OS=Homo sapiens OX=9606 GN=FOXG1 PE=1 SV=2
20	F1QDF8	1.96e-30	127	458	0.082	0.118	FXJ1A_DANRE Forkhead box protein J1-A OS=Danio rerio OX=7955 GN=foxj1a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	0.00041	31.9	FHA domain
2	PF00250 Forkhead	5.7e-33	124.2	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335677

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417132	0.981	Ubiquitin carboxyl-terminal hydrolase BAP1
2	9606.ENSP00000309555	0.977	Host cell factor 1
3	9606.ENSP00000383920	0.938	Putative Polycomb group protein ASXL2
4	9606.ENSP00000332194	0.918	Histone H2A type 2-C
5	9606.ENSP00000367022	0.914	Histone H2A type 1-C
6	9606.ENSP00000297012	0.907	Histone H2A type 1-A
7	9606.ENSP00000332790	0.907	Histone H2A type 2-B
8	9606.ENSP00000355656	0.907	Histone H2A type 3
9	9606.ENSP00000366679	0.907	Histone H2A type 1-H
10	9606.ENSP00000328484	0.903	Histone H2A type 1-J
11	9606.ENSP00000341094	0.903	Histone H2A type 1-D
12	9606.ENSP00000378402	0.903	Paired amphipathic helix protein Sin3a
13	9606.ENSP00000388107	0.902	Ubiquitin-60S ribosomal protein L40
14	9606.ENSP00000272317	0.901	Ubiquitin-40S ribosomal protein S27a
15	9606.ENSP00000304697	0.901	Polyubiquitin-B
16	9606.ENSP00000441543	0.901	Polyubiquitin-C
17	9606.ENSP00000347896	0.862	Methyl-CpG-binding domain protein 6
18	9606.ENSP00000364839	0.859	Putative Polycomb group protein ASXL1
19	9606.ENSP00000268712	0.830	Nuclear receptor corepressor 1
20	9606.ENSP00000386049	0.823	Methyl-CpG-binding domain protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.983	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.978	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000287	0.918	magnesium ion binding
GO:0001227	0.350	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.997	regulation of gene expression
GO:0010556	0.995	regulation of macromolecule biosynthetic process
GO:0031326	0.995	regulation of cellular biosynthetic process
GO:0051252	0.995	regulation of RNA metabolic process
GO:0006355	0.994	regulation of DNA-templated transcription
GO:0048518	0.962	positive regulation of biological process
GO:0048519	0.960	negative regulation of biological process
GO:0048523	0.947	negative regulation of cellular process
GO:0048522	0.943	positive regulation of cellular process
GO:0045935	0.907	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.906	positive regulation of macromolecule biosynthetic process
GO:0031328	0.904	positive regulation of cellular biosynthetic process
GO:0051253	0.899	negative regulation of RNA metabolic process
GO:0051254	0.895	positive regulation of RNA metabolic process
GO:0045893	0.894	positive regulation of DNA-templated transcription
GO:0045892	0.892	negative regulation of DNA-templated transcription
GO:0006357	0.768	regulation of transcription by RNA polymerase II
GO:0009987	0.533	cellular process
GO:0045944	0.433	positive regulation of transcription by RNA polymerase II
GO:0071704	0.388	organic substance metabolic process
GO:0044238	0.360	primary metabolic process
GO:0006807	0.313	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]