StarFunc result for job id Q01196

User Input

>input (453 residues)
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPG
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM
QDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDL
TAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPG
SSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP
NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E1BAD4	0.397	0.375	2.963E-61	480	0.978	0.923	E1BAD4.pdb.gz	E1BAD4_BOVIN Runt-related transcription factor OS=Bos taurus OX=9913 GN=RUNX1 PE=4 SV=2
2	AFDB:Q8UVG3	0.353	0.340	1.918E-44	472	0.673	0.646	Q8UVG3.pdb.gz	Q8UVG3_CHICK Runt-related transcription factor OS=Gallus gallus OX=9031 GN=Runx2 PE=2 SV=1
3	AFDB:Q6TYZ4	0.363	0.348	1.732E-43	474	0.640	0.612	Q6TYZ4.pdb.gz
4	AFDB:E1BAC1	0.286	0.429	6.744E-27	302	0.386	0.579	E1BAC1.pdb.gz	E1BAC1_BOVIN RUNX family transcription factor 2 OS=Bos taurus OX=9913 GN=RUNX2 PE=4 SV=3
5	AFDB:R9PY33	0.287	0.200	8.164E-25	651	0.331	0.230	R9PY33.pdb.gz	R9PY33_DROME Runt related A, isoform C OS=Drosophila melanogaster OX=7227 GN=RunxA PE=4 SV=1
6	AFDB:Q9W349	0.322	0.178	5.313E-23	826	0.331	0.182	Q9W349.pdb.gz	LOZEN_DROME Protein lozenge OS=Drosophila melanogaster OX=7227 GN=lz PE=2 SV=2
7	AFDB:G5EFQ5	0.282	0.419	7.031E-18	301	0.223	0.336	G5EFQ5.pdb.gz	RUNX1_CAEEL Runt-related transcription factor rnt-1 OS=Caenorhabditis elegans OX=6239 GN=rnt-1 PE=1 SV=1
8	AFDB:Q91Y12	0.118	0.065	8.191E-4	946	0.113	0.054	Q91Y12.pdb.gz	Q91Y12_MOUSE Protocadherin alpha 8 OS=Mus musculus OX=10090 GN=Pcdha8 PE=2 SV=1
9	AFDB:Q91Y20	0.133	0.070	1.149E-3	946	0.110	0.053	Q91Y20.pdb.gz	PCDAA_MOUSE Protocadherin alpha-10 OS=Mus musculus OX=10090 GN=Pcdha10 PE=2 SV=1
10	AFDB:Q91Y21	0.128	0.068	1.149E-3	948	0.110	0.053	Q91Y21.pdb.gz	Q91Y21_MOUSE Protocadherin alpha 1 OS=Mus musculus OX=10090 GN=Pcdha1 PE=2 SV=1
11	PDB:6cxcB	0.079	0.094	6.031E-2	358	0.038	0.047	6cxcB.pdb.gz
12	PDB:4y5xB	0.128	0.385	7.997E-2	111	0.018	0.072	4y5xB.pdb.gz
13	PDB:5n0zA	0.124	0.092	1.060E-1	638	0.031	0.022	5n0zA.pdb.gz	Development of a Selective Inhibitor of Protein Arginine Deiminase 2.
14	PDB:5a42A	0.165	0.053	1.488E-1	1597	0.026	0.008	5a42A.pdb.gz
15	PDB:1gafL	0.146	0.269	1.864E-1	214	0.020	0.042	1gafL.pdb.gz	The immunological evolution of catalysis.
16	PDB:2hkaB	0.178	0.483	1.973E-1	130	0.020	0.069	2hkaB.pdb.gz	Structural Basis of Sterol Binding by NPC2, a Lysosomal Protein Deficient in Niemann-Pick Type C2 Disease
17	PDB:7ajtUO	0.078	0.073	2.208E-1	493	0.051	0.047	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:4edqA	0.138	0.131	2.336E-1	483	0.026	0.025	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
19	PDB:1rowA	0.105	0.336	2.616E-1	107	0.026	0.112	1rowA.pdb.gz
20	PDB:7z0lB	0.121	0.141	2.928E-1	370	0.022	0.027	7z0lB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D9SEN7	0.0	551	485	0.693	0.647	A0A0D9SEN7_HUMAN Runt-related transcription factor OS=Homo sapiens OX=9606 GN=RUNX2 PE=1 SV=1
2	E1BAD4	0.0	899	480	0.976	0.921	E1BAD4_BOVIN Runt-related transcription factor OS=Bos taurus OX=9913 GN=RUNX1 PE=4 SV=2
3	F1M9C5	0.0	534	608	0.627	0.467	F1M9C5_RAT RUNX family transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Runx2 PE=4 SV=3
4	Q01196	0.0	921	453	1.000	1.000	RUNX1_HUMAN Runt-related transcription factor 1 OS=Homo sapiens OX=9606 GN=RUNX1 PE=1 SV=3
5	Q03347	0.0	873	451	0.956	0.960	RUNX1_MOUSE Runt-related transcription factor 1 OS=Mus musculus OX=10090 GN=Runx1 PE=1 SV=1
6	Q08775	0.0	534	607	0.627	0.468	RUNX2_MOUSE Runt-related transcription factor 2 OS=Mus musculus OX=10090 GN=Runx2 PE=1 SV=2
7	Q13950	0.0	536	521	0.631	0.549	RUNX2_HUMAN Runt-related transcription factor 2 OS=Homo sapiens OX=9606 GN=RUNX2 PE=1 SV=2
8	Q63046	0.0	870	450	0.954	0.960	RUNX1_RAT Runt-related transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Runx1 PE=1 SV=1
9	Q8UVG3	0.0	552	472	0.682	0.655	Q8UVG3_CHICK Runt-related transcription factor OS=Gallus gallus OX=9031 GN=Runx2 PE=2 SV=1
10	Q8UWC8	0.0	548	472	0.680	0.653	Q8UWC8_CHICK Runt-related transcription factor OS=Gallus gallus OX=9031 PE=2 SV=1
11	Q9DGB8	0.0	597	451	0.746	0.749	Q9DGB8_DANRE Runt-related transcription factor OS=Danio rerio OX=7955 GN=runxa PE=2 SV=1
12	A8MZI9	4.56e-173	487	256	0.521	0.922	A8MZI9_HUMAN RUNX family transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=RUNX1 PE=1 SV=2
13	Q13761	9.84e-168	479	415	0.605	0.660	RUNX3_HUMAN Runt-related transcription factor 3 OS=Homo sapiens OX=9606 GN=RUNX3 PE=1 SV=2
14	H9KVB1	1.07e-165	473	389	0.623	0.725	H9KVB1_HUMAN Runt-related transcription factor OS=Homo sapiens OX=9606 GN=RUNX1 PE=1 SV=1
15	Q64131	1.54e-162	466	409	0.589	0.653	RUNX3_MOUSE Runt-related transcription factor 3 OS=Mus musculus OX=10090 GN=Runx3 PE=1 SV=3
16	Q9DEA0	1.30e-155	449	424	0.561	0.599	Q9DEA0_DANRE Runt-related transcription factor OS=Danio rerio OX=7955 GN=Runx3 PE=2 SV=1
17	I3L0L0	2.96e-116	353	542	0.389	0.325	I3L0L0_HUMAN RUNX family transcription factor 2 OS=Homo sapiens OX=9606 GN=RUNX2 PE=1 SV=1
18	Q9DDG3	2.13e-94	286	236	0.344	0.661	Q9DDG3_CHICK Core binding factor alpha 1 (Fragment) OS=Gallus gallus OX=9031 GN=CBFA1 PE=2 SV=1
19	E1BAC1	7.42e-86	266	302	0.331	0.497	E1BAC1_BOVIN RUNX family transcription factor 2 OS=Bos taurus OX=9913 GN=RUNX2 PE=4 SV=3
20	Q9Z2J9	1.49e-68	219	218	0.238	0.495	RUNX2_RAT Runt-related transcription factor 2 (Fragments) OS=Rattus norvegicus OX=10116 GN=Runx2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11236 DUF3037	2.6e+02	13.4	Protein of unknown function (DUF3037)
2	PF00853 Runt	7.1e-71	247.2	Runt domain
3	PF08504 RunxI	2e-37	139.1	Runx inhibition domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9913.ENSBTAP00000006224

Rank	PPI partner	STRING score	Description
1	9913.ENSBTAP00000021434	0.994	Core-binding factor, beta subunit
2	9913.ENSBTAP00000017660	0.972	Forkhead box P3
3	9913.ENSBTAP00000016877	0.964	Histone deacetylase 1
4	9913.ENSBTAP00000003022	0.948	ETS proto-oncogene 1, transcription factor
5	9913.ENSBTAP00000018875	0.936	Bos taurus T-box 21 (TBX21), mRNA
6	9913.ENSBTAP00000023058	0.927	RUNX1 translocation partner 1
7	9913.ENSBTAP00000028937	0.927	Spi-1 proto-oncogene
8	9913.ENSBTAP00000016977	0.867	Bos taurus colony stimulating factor 1 receptor (CSF1R), mRNA
9	9913.ENSBTAP00000007717	0.850	MDS1 and EVI1 complex locus
10	9913.ENSBTAP00000011166	0.847	C-terminal binding protein 1
11	9913.ENSBTAP00000002774	0.846	Interleukin-3
12	9913.ENSBTAP00000016989	0.843	Bos taurus myeloperoxidase (MPO), mRNA
13	9913.ENSBTAP00000004405	0.835	C-terminal-binding protein 2
14	9913.ENSBTAP00000002054	0.829	Granulocyte-macrophage colony-stimulating factor
15	9913.ENSBTAP00000013167	0.797	SIN3 transcription regulator family member A
16	9913.ENSBTAP00000017649	0.794	Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD2/SMAD4 complex, activates transcription. May act as a tumor suppressor in colorectal carcinoma. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator (By similarity)
17	9913.ENSBTAP00000012144	0.791	Transcription factor activating transcription. Binds specifically the GGA DNA motif in gene promoters and stimulates transcription of those genes (By similarity)
18	9913.ENSBTAP00000006112	0.780	Uncharacterized protein
19	9913.ENSBTAP00000021556	0.766	E1A binding protein p300
20	9913.ENSBTAP00000008728	0.745	Bos taurus retinoblastoma 1 (RB1), mRNA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0000977	0.997	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.994	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0016922	0.955	nuclear receptor binding
GO:0042809	0.954	nuclear vitamin D receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.997	positive regulation of biological process
GO:0019222	0.997	regulation of metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0010604	0.987	positive regulation of macromolecule metabolic process
GO:0010468	0.984	regulation of gene expression
GO:0051171	0.942	regulation of nitrogen compound metabolic process
GO:0080090	0.935	regulation of primary metabolic process
GO:0031323	0.929	regulation of cellular metabolic process
GO:0051173	0.910	positive regulation of nitrogen compound metabolic process
GO:0031325	0.907	positive regulation of cellular metabolic process
GO:0009889	0.886	regulation of biosynthetic process
GO:0019219	0.872	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.830	regulation of RNA metabolic process
GO:0010556	0.807	regulation of macromolecule biosynthetic process
GO:0031326	0.807	regulation of cellular biosynthetic process
GO:2001141	0.800	regulation of RNA biosynthetic process
GO:1903506	0.790	regulation of nucleic acid-templated transcription
GO:0009891	0.789	positive regulation of biosynthetic process
GO:0006355	0.780	regulation of DNA-templated transcription
GO:0051239	0.776	regulation of multicellular organismal process
GO:0045935	0.775	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.759	positive regulation of DNA-templated transcription
GO:0009987	0.585	cellular process
GO:0032501	0.501	multicellular organismal process
GO:0032502	0.422	developmental process
GO:0010628	0.416	positive regulation of gene expression
GO:0007275	0.410	multicellular organism development
GO:0030154	0.397	cell differentiation
GO:0048731	0.387	system development
GO:0051240	0.338	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0032991	0.988	protein-containing complex
GO:0005667	0.945	transcription regulator complex
GO:0016513	0.943	core-binding factor complex
GO:0005654	0.916	nucleoplasm
GO:0071944	0.325	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]