StarFunc result for job id Q01201

User Input

>input (579 residues)
MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEY
IKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPG
PGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEV
TACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIE
RKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNT
SELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIV
FKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLG
ELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPG
GPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQ
APGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01201	0.999	0.999	1.851E-94	579	1.000	1.000	Q01201.pdb.gz	RELB_HUMAN Transcription factor RelB OS=Homo sapiens OX=9606 GN=RELB PE=1 SV=2
2	AFDB:P16236	0.493	0.477	4.972E-43	598	0.309	0.299	P16236.pdb.gz	REL_CHICK Proto-oncogene c-Rel OS=Gallus gallus OX=9031 GN=REL PE=1 SV=2
3	AFDB:Q04864	0.488	0.457	6.372E-41	619	0.299	0.279	Q04864.pdb.gz	REL_HUMAN Proto-oncogene c-Rel OS=Homo sapiens OX=9606 GN=REL PE=1 SV=1
4	AFDB:P15307	0.486	0.479	1.153E-40	587	0.302	0.298	P15307.pdb.gz	REL_MOUSE Proto-oncogene c-Rel OS=Mus musculus OX=10090 GN=Rel PE=1 SV=2
5	AFDB:P98149	0.414	0.364	7.175E-37	667	0.268	0.232	P98149.pdb.gz	DIF_DROME Dorsal-related immunity factor Dif OS=Drosophila melanogaster OX=7227 GN=Dif PE=1 SV=2
6	AFDB:Q94527	0.430	0.264	1.478E-28	971	0.230	0.137	Q94527.pdb.gz	NFKB1_DROME Nuclear factor NF-kappa-B p110 subunit OS=Drosophila melanogaster OX=7227 GN=Rel PE=1 SV=1
7	AFDB:F1QUZ9	0.269	0.190	9.974E-20	867	0.209	0.140	F1QUZ9.pdb.gz
8	AFDB:D4A0I8	0.260	0.175	2.313E-17	931	0.188	0.117	D4A0I8.pdb.gz	D4A0I8_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
9	AFDB:O08791	0.147	0.143	9.607E-9	596	0.162	0.158	O08791.pdb.gz	COE3_MOUSE Transcription factor COE3 OS=Mus musculus OX=10090 GN=Ebf3 PE=1 SV=1
10	AFDB:Q8N6P7	0.171	0.172	1.231E-6	574	0.092	0.092	Q8N6P7.pdb.gz	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL22RA1 PE=1 SV=1
11	PDB:7nxdA	0.196	0.141	2.508E-4	905	0.059	0.038	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
12	PDB:2q3zA	0.198	0.181	3.284E-4	655	0.043	0.038	2q3zA.pdb.gz	Transglutaminase 2 undergoes a large conformational change upon activation
13	PDB:3s3sA	0.201	0.190	4.075E-4	620	0.036	0.034	3s3sA.pdb.gz	Inhibitors of Transglutaminase 2: A therapeutic option in celiac disease
14	PDB:6vxkB	0.136	0.107	4.075E-4	747	0.026	0.020	6vxkB.pdb.gz
15	PDB:3fcsA	0.152	0.111	1.019E-3	913	0.050	0.032	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
16	PDB:5ghuA	0.147	0.306	1.265E-3	201	0.043	0.124	5ghuA.pdb.gz
17	PDB:1l9mB	0.194	0.174	2.289E-3	681	0.050	0.043	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
18	PDB:7u05B	0.162	0.125	2.549E-3	815	0.036	0.026	7u05B.pdb.gz
19	PDB:4pygA	0.204	0.179	3.338E-3	685	0.045	0.038	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
20	PDB:2ig2H	0.170	0.308	4.142E-3	238	0.040	0.097	2ig2H.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z9V1	0.0	927	556	0.851	0.887	D3Z9V1_RAT RELB proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Relb PE=4 SV=4
2	D4A8H1	0.0	938	559	0.857	0.887	D4A8H1_RAT RELB proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Relb PE=4 SV=4
3	D6R992	0.0	1159	576	0.995	1.000	D6R992_HUMAN RELB proto-oncogene, NF-kB subunit OS=Homo sapiens OX=9606 GN=RELB PE=1 SV=1
4	Q01201	0.0	1171	579	1.000	1.000	RELB_HUMAN Transcription factor RelB OS=Homo sapiens OX=9606 GN=RELB PE=1 SV=2
5	Q04863	0.0	933	558	0.862	0.894	RELB_MOUSE Transcription factor RelB OS=Mus musculus OX=10090 GN=Relb PE=1 SV=2
6	Q8K220	0.0	921	555	0.857	0.894	Q8K220_MOUSE Avian reticuloendotheliosis viral (v-rel) oncogene related B OS=Mus musculus OX=10090 GN=Relb PE=1 SV=1
7	A0A087X0W8	4.01e-101	315	448	0.271	0.350	A0A087X0W8_HUMAN RELA proto-oncogene, NF-kB subunit OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
8	A0A8I5ZMV7	8.11e-101	318	557	0.275	0.285	A0A8I5ZMV7_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
9	Q04206	1.65e-100	317	551	0.271	0.285	TF65_HUMAN Transcription factor p65 OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=2
10	F7F7J5	1.87e-100	317	541	0.266	0.285	F7F7J5_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
11	A0A8I6A5H5	2.16e-100	317	550	0.269	0.284	A0A8I6A5H5_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
12	Q7TQN4	2.21e-100	317	550	0.269	0.284	Q7TQN4_RAT Nuclear factor kappaB subunit p65 OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
13	Q2TAM5	3.42e-100	310	377	0.271	0.416	Q2TAM5_HUMAN RELA protein OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
14	Q04207	8.07e-100	315	549	0.269	0.284	TF65_MOUSE Transcription factor p65 OS=Mus musculus OX=10090 GN=Rela PE=1 SV=1
15	E9PKH5	4.68e-99	309	418	0.271	0.376	E9PKH5_HUMAN RELA proto-oncogene, NF-kB subunit (Fragment) OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
16	Q6DGE6	1.28e-94	303	596	0.268	0.260	Q6DGE6_DANRE Proto-oncogene c-Rel OS=Danio rerio OX=7955 GN=c-rel PE=1 SV=1
17	B3DHW2	5.48e-93	294	455	0.256	0.325	B3DHW2_DANRE Transcription factor p65 OS=Danio rerio OX=7955 GN=nfkb3 PE=1 SV=1
18	P16236	1.93e-91	295	598	0.280	0.271	REL_CHICK Proto-oncogene c-Rel OS=Gallus gallus OX=9031 GN=REL PE=1 SV=2
19	F1M5R1	8.63e-91	292	566	0.256	0.261	F1M5R1_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=3
20	A0A8I5XW27	1.55e-90	292	585	0.256	0.253	A0A8I5XW27_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16180 RelB_leu_zip	3.6e-37	137.6	RelB leucine zipper
2	PF16181 RelB_transactiv	2.4e-88	306.6	RelB transactivation domain
3	PF16179 RHD_dimer	5.1e-33	124.5	Rel homology dimerisation domain
4	PF00554 RHD_DNA_bind	3.4e-60	214.3	Rel homology DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221452

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000226574	0.999	Nuclear factor NF-kappa-B p105 subunit
2	9606.ENSP00000358983	0.999	Nuclear factor NF-kappa-B p100 subunit
3	9606.ENSP00000359424	0.998	Inhibitor of nuclear factor kappa-B kinase subunit alpha
4	9606.ENSP00000216797	0.997	NF-kappa-B inhibitor alpha
5	9606.ENSP00000242057	0.989	Aryl hydrocarbon receptor
6	9606.ENSP00000361359	0.988	Tumor necrosis factor receptor superfamily member 5
7	9606.ENSP00000384273	0.979	Transcription factor p65
8	9606.ENSP00000482657	0.958	Mitogen-activated protein kinase kinase kinase 14
9	9606.ENSP00000264606	0.955	Histone deacetylase 4
10	9606.ENSP00000275015	0.954	NF-kappa-B inhibitor epsilon
11	9606.ENSP00000295025	0.952	Proto-oncogene c-Rel
12	9606.ENSP00000164227	0.944	B-cell lymphoma 3 protein
13	9606.ENSP00000359206	0.934	F-box/WD repeat-containing protein 1A
14	9606.ENSP00000371067	0.925	Tyrosine-protein kinase JAK2
15	9606.ENSP00000262238	0.919	Transcriptional repressor protein YY1
16	9606.ENSP00000431885	0.919	Non-receptor tyrosine-protein kinase TYK2
17	9606.ENSP00000470788	0.910	Interleukin-12 receptor subunit beta-1
18	9606.ENSP00000262345	0.909	Interleukin-12 receptor subunit beta-2
19	9606.ENSP00000272317	0.909	Ubiquitin-40S ribosomal protein S27a
20	9606.ENSP00000303231	0.905	Interleukin-12 subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000977	0.997	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.994	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0019899	0.980	enzyme binding
GO:0019900	0.887	kinase binding
GO:0019901	0.880	protein kinase binding
GO:0140110	0.748	transcription regulator activity
GO:0003700	0.573	DNA-binding transcription factor activity
GO:0000981	0.307	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.992	response to stimulus
GO:0050789	0.989	regulation of biological process
GO:0050794	0.970	regulation of cellular process
GO:0019219	0.948	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.946	regulation of cellular biosynthetic process
GO:0010556	0.945	regulation of macromolecule biosynthetic process
GO:2001141	0.942	regulation of RNA biosynthetic process
GO:0051716	0.933	cellular response to stimulus
GO:0048519	0.923	negative regulation of biological process
GO:0048518	0.919	positive regulation of biological process
GO:0032502	0.917	developmental process
GO:0006355	0.909	regulation of DNA-templated transcription
GO:0048522	0.900	positive regulation of cellular process
GO:0010604	0.882	positive regulation of macromolecule metabolic process
GO:0032501	0.858	multicellular organismal process
GO:0051173	0.823	positive regulation of nitrogen compound metabolic process
GO:0048856	0.803	anatomical structure development
GO:0042221	0.796	response to chemical
GO:0023052	0.795	signaling
GO:0007154	0.795	cell communication
GO:0006950	0.791	response to stress
GO:0031325	0.771	positive regulation of cellular metabolic process
GO:0007165	0.765	signal transduction
GO:0002376	0.746	immune system process
GO:0051239	0.744	regulation of multicellular organismal process
GO:0070887	0.738	cellular response to chemical stimulus
GO:0048523	0.707	negative regulation of cellular process
GO:0071214	0.678	cellular response to abiotic stimulus
GO:0006357	0.673	regulation of transcription by RNA polymerase II
GO:0048583	0.672	regulation of response to stimulus
GO:0033554	0.663	cellular response to stress
GO:0010605	0.644	negative regulation of macromolecule metabolic process
GO:0001775	0.625	cell activation
GO:0001817	0.620	regulation of cytokine production
GO:0071470	0.598	cellular response to osmotic stress
GO:0030154	0.553	cell differentiation
GO:0045893	0.548	positive regulation of DNA-templated transcription
GO:0030097	0.473	hemopoiesis
GO:0023051	0.412	regulation of signaling
GO:0010646	0.408	regulation of cell communication
GO:0010033	0.395	response to organic substance
GO:0009966	0.390	regulation of signal transduction
GO:0071704	0.386	organic substance metabolic process
GO:0051240	0.335	positive regulation of multicellular organismal process
GO:0009605	0.331	response to external stimulus
GO:0071310	0.330	cellular response to organic substance
GO:0045944	0.330	positive regulation of transcription by RNA polymerase II
GO:0051172	0.310	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005737	0.996	cytoplasm
GO:0005829	0.988	cytosol
GO:0031981	0.986	nuclear lumen
GO:0005654	0.982	nucleoplasm
GO:0032991	0.881	protein-containing complex
GO:0005667	0.382	transcription regulator complex
GO:0000785	0.368	chromatin
GO:0017053	0.367	transcription repressor complex
GO:0005856	0.367	cytoskeleton
GO:0015630	0.360	microtubule cytoskeleton
GO:0005813	0.351	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]