StarFunc result for job id Q01344

User Input

>input (420 residues)
MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA
PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQIN
PPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMATICFILLILSL
ICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01344	1.000	1.000	3.559E-71	420	1.000	1.000	Q01344.pdb.gz	IL5RA_HUMAN Interleukin-5 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL5RA PE=1 SV=2
2	AFDB:G3V6S7	0.725	0.680	2.332E-55	448	0.671	0.629	G3V6S7.pdb.gz	G3V6S7_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=2
3	AFDB:P21183	0.725	0.734	1.402E-53	415	0.657	0.665	P21183.pdb.gz	IL5RA_MOUSE Interleukin-5 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il5ra PE=1 SV=1
4	AFDB:Q14627	0.655	0.718	1.061E-25	380	0.233	0.258	Q14627.pdb.gz	I13R2_HUMAN Interleukin-13 receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=IL13RA2 PE=1 SV=1
5	AFDB:Q8VHK6	0.629	0.683	2.869E-24	385	0.229	0.249	Q8VHK6.pdb.gz	I13R2_RAT Interleukin-13 receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Il13ra2 PE=2 SV=1
6	AFDB:Q561K3	0.648	0.640	2.013E-23	426	0.217	0.214	Q561K3.pdb.gz	Q561K3_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
7	AFDB:P78552	0.625	0.616	2.585E-23	427	0.207	0.204	P78552.pdb.gz	I13R1_HUMAN Interleukin-13 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL13RA1 PE=1 SV=1
8	AFDB:P15509	0.564	0.589	4.457E-22	400	0.219	0.230	P15509.pdb.gz	CSF2R_HUMAN Granulocyte-macrophage colony-stimulating factor receptor subunit alpha OS=Homo sapiens OX=9606 GN=CSF2RA PE=1 SV=1
9	AFDB:P26951	0.525	0.577	4.881E-20	378	0.233	0.259	P26951.pdb.gz	IL3RA_HUMAN Interleukin-3 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL3RA PE=1 SV=1
10	AFDB:E6ZCC8	0.555	0.595	9.344E-20	387	0.186	0.202	E6ZCC8.pdb.gz	E6ZCC8_ONCMY IL-13 receptor-alpha-1-a OS=Oncorhynchus mykiss OX=8022 GN=il13Ra1A PE=2 SV=1
11	PDB:7u7nC	0.343	0.655	8.677E-9	200	0.088	0.185	7u7nC.pdb.gz
12	PDB:7z0lB	0.361	0.405	1.836E-8	370	0.102	0.116	7z0lB.pdb.gz
13	PDB:6pxvA	0.210	0.119	2.123E-7	823	0.098	0.050	6pxvA.pdb.gz
14	PDB:8eyyA	0.214	0.125	2.123E-7	775	0.102	0.055	8eyyA.pdb.gz
15	PDB:8dtlA	0.201	0.121	3.328E-7	741	0.112	0.063	8dtlA.pdb.gz
16	PDB:6pyhD	0.210	0.121	7.401E-7	798	0.098	0.051	6pyhD.pdb.gz
17	PDB:5mj3A	0.329	0.435	8.598E-7	302	0.105	0.146	5mj3A.pdb.gz
18	PDB:3besR	0.273	0.412	1.094E-4	250	0.062	0.104	3besR.pdb.gz
19	PDB:1e07A	0.254	0.183	1.150E-4	642	0.081	0.053	1e07A.pdb.gz
20	PDB:7q5zA	0.154	0.065	1.895E-4	1344	0.076	0.024	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A448	0.0	546	403	0.636	0.663	A0A8I6A448_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=1
2	G3V6S7	0.0	591	448	0.671	0.629	G3V6S7_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=2
3	P21183	0.0	591	415	0.679	0.687	IL5RA_MOUSE Interleukin-5 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il5ra PE=1 SV=1
4	Q01344	0.0	869	420	1.000	1.000	IL5RA_HUMAN Interleukin-5 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL5RA PE=1 SV=2
5	Q99PS3	0.0	584	414	0.664	0.674	Q99PS3_RAT Interleukin-5 receptor alpha chain OS=Rattus norvegicus OX=10116 GN=Il5ra PE=2 SV=1
6	Q14627	8.16e-25	107	380	0.229	0.253	I13R2_HUMAN Interleukin-13 receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=IL13RA2 PE=1 SV=1
7	P15509	4.79e-22	99.4	400	0.200	0.210	CSF2R_HUMAN Granulocyte-macrophage colony-stimulating factor receptor subunit alpha OS=Homo sapiens OX=9606 GN=CSF2RA PE=1 SV=1
8	Q561K3	3.47e-15	79.3	426	0.190	0.188	Q561K3_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
9	P26951	1.86e-14	76.6	378	0.212	0.235	IL3RA_HUMAN Interleukin-3 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL3RA PE=1 SV=1
10	P78552	2.43e-14	76.6	427	0.190	0.187	I13R1_HUMAN Interleukin-13 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL13RA1 PE=1 SV=1
11	Q8VHK6	6.71e-14	75.1	385	0.195	0.213	I13R2_RAT Interleukin-13 receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Il13ra2 PE=2 SV=1
12	A0A8I6A7D4	1.68e-13	73.9	390	0.181	0.195	A0A8I6A7D4_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
13	O88786	4.96e-12	69.3	383	0.193	0.211	I13R2_MOUSE Interleukin-13 receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Il13ra2 PE=1 SV=1
14	E6ZCC8	1.33e-11	68.2	387	0.155	0.168	E6ZCC8_ONCMY IL-13 receptor-alpha-1-a OS=Oncorhynchus mykiss OX=8022 GN=il13Ra1A PE=2 SV=1
15	Q9DE08	1.80e-08	58.9	638	0.188	0.124	Q9DE08_ONCMY Prolactin receptor OS=Oncorhynchus mykiss OX=8022 GN=PRLR PE=2 SV=1
16	P34902	3.87e-08	57.4	369	0.140	0.160	IL2RG_MOUSE Cytokine receptor common subunit gamma OS=Mus musculus OX=10090 GN=Il2rg PE=1 SV=1
17	Q6EIY6	7.63e-08	57.0	614	0.176	0.121	Q6EIY6_DANRE Myeloproliferative leukemia virus oncogene, like OS=Danio rerio OX=7955 GN=mpll PE=2 SV=1
18	M0R536	1.70e-07	55.1	355	0.145	0.172	M0R536_RAT Colony stimulating factor 2 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Csf2ra PE=1 SV=3
19	Q9JHX3	4.56e-07	54.3	529	0.119	0.095	IL21R_MOUSE Interleukin-21 receptor OS=Mus musculus OX=10090 GN=Il21r PE=2 SV=1
20	P05710	7.16e-07	53.9	610	0.162	0.111	PRLR_RAT Prolactin receptor OS=Rattus norvegicus OX=10116 GN=Prlr PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	5.3	18.8	Fibronectin type III domain
2	PF09240 IL6Ra-bind	9.8e-21	85.4	Interleukin-6 receptor alpha chain, binding
3	PF17971 LIFR_D2	1.5e+02	14.0	Leukemia inhibitory factor receptor D2 domain
4	PF01108 Tissue_fac	0.0012	30.1	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000412209

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231454	0.999	Interleukin-5
2	9606.ENSP00000260130	0.993	Syntenin-1
3	9606.ENSP00000384053	0.993	Cytokine receptor common subunit beta
4	9606.ENSP00000428924	0.969	Tyrosine-protein kinase Lyn
5	9606.ENSP00000371067	0.947	Tyrosine-protein kinase JAK2
6	9606.ENSP00000341208	0.920	Signal transducer and activator of transcription 5A
7	9606.ENSP00000293328	0.919	Signal transducer and activator of transcription 5B
8	9606.ENSP00000376345	0.912	Growth factor receptor-bound protein 2
9	9606.ENSP00000340944	0.904	Tyrosine-protein phosphatase non-receptor type 11
10	9606.ENSP00000428056	0.904	Phosphatidylinositol 3-kinase regulatory subunit alpha
11	9606.ENSP00000263967	0.900	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
12	9606.ENSP00000309591	0.900	cAMP-dependent protein kinase catalytic subunit alpha
13	9606.ENSP00000296870	0.850	Interleukin-3
14	9606.ENSP00000296871	0.830	Granulocyte-macrophage colony-stimulating factor
15	9606.ENSP00000231449	0.802	Interleukin-4
16	9606.ENSP00000304915	0.793	Interleukin-13
17	9606.ENSP00000339804	0.751	Thymic stromal lymphopoietin
18	9606.ENSP00000343204	0.746	Tyrosine-protein kinase JAK1
19	9606.ENSP00000274520	0.729	Interleukin-9
20	9606.ENSP00000244745	0.720	Transcription factor SOX-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0009987	0.999	cellular process
GO:0050794	0.999	regulation of cellular process
GO:0023052	0.997	signaling
GO:0048518	0.990	positive regulation of biological process
GO:0007165	0.985	signal transduction
GO:0048522	0.984	positive regulation of cellular process
GO:0008284	0.937	positive regulation of cell population proliferation
GO:0070665	0.895	positive regulation of leukocyte proliferation
GO:0019222	0.757	regulation of metabolic process
GO:0060255	0.725	regulation of macromolecule metabolic process
GO:0042221	0.587	response to chemical
GO:0051239	0.508	regulation of multicellular organismal process
GO:0010468	0.507	regulation of gene expression
GO:0007166	0.506	cell surface receptor signaling pathway
GO:0010033	0.475	response to organic substance
GO:0009893	0.412	positive regulation of metabolic process
GO:0071310	0.406	cellular response to organic substance
GO:0010604	0.370	positive regulation of macromolecule metabolic process
GO:0002376	0.357	immune system process
GO:0006950	0.355	response to stress
GO:0048583	0.345	regulation of response to stimulus
GO:0019221	0.334	cytokine-mediated signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005615	0.997	extracellular space
GO:0032991	0.629	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]