StarFunc result for job id Q01432

User Input

>input (767 residues)
MPRQFPKLNISEVDEQVRLLAEKVFAKVLREEDSKDALSLFTVPEDCPIGQKEAKERELQ
KELAEQKSVETAKRKKSFKMIRSQSLSLQMPPQQDWKGPPAASPAMSPTTPVVTGATSLP
TPAPYAMPEFQRVTISGDYCAGITLEDYEQAAKSLAKALMIREKYARLAYHRFPRITSQY
LGHPRADTAPPEEGLPDFHPPPLPQEDPYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEH
QEPHSLPYPDLETYTVDMSHILALITDGPTKTYCHRRLNFLESKFSLHEMLNEMSEFKEL
KSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEPDRTVAEKRGRKITLRQVFD
GLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLGGEYFARM
VKEVARELEESKYQYSEPRLSIYGRSPEEWPNLAYWFIQHKVYSPNMRWIIQVPRIYDIF
RSKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDK
SPNPDVWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAF
LTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSL
STDDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSHQEKQKFLGQNYY
KEGPEGNDIRKTNVAQIRMAFRYETLCNELSFLSDAMKSEEITALTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01432	1.000	1.000	0.000	767	1.000	1.000	Q01432.pdb.gz	AMPD3_HUMAN AMP deaminase 3 OS=Homo sapiens OX=9606 GN=AMPD3 PE=1 SV=1
2	AFDB:P10759	0.859	0.881	4.885E-84	747	0.587	0.602	P10759.pdb.gz	AMPD1_RAT AMP deaminase 1 OS=Rattus norvegicus OX=10116 GN=Ampd1 PE=1 SV=1
3	AFDB:Q01433	0.843	0.738	1.429E-72	879	0.510	0.445	Q01433.pdb.gz	AMPD2_HUMAN AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=3
4	AFDB:X2JEY5	0.799	0.769	3.048E-70	798	0.471	0.452	X2JEY5.pdb.gz	X2JEY5_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=1
5	AFDB:P15274	0.750	0.711	3.395E-63	810	0.399	0.378	P15274.pdb.gz	AMPD_YEAST AMP deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AMD1 PE=1 SV=2
6	AFDB:P50998	0.747	0.691	2.029E-62	831	0.396	0.366	P50998.pdb.gz	AMPD_SCHPO AMP deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ada1 PE=1 SV=3
7	AFDB:O80452	0.753	0.689	8.795E-62	839	0.416	0.380	O80452.pdb.gz	AMPD_ARATH AMP deaminase OS=Arabidopsis thaliana OX=3702 GN=AMPD PE=1 SV=2
8	AFDB:Q54DD0	0.754	0.733	6.609E-61	790	0.400	0.389	Q54DD0.pdb.gz	AMPD_DICDI AMP deaminase OS=Dictyostelium discoideum OX=44689 GN=amdA PE=1 SV=1
9	AFDB:Q38E23	0.733	0.403	9.693E-54	1417	0.335	0.181	Q38E23.pdb.gz	Q38E23_TRYB2 AMP deaminase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1320 PE=3 SV=1
10	AFDB:Q386C9	0.707	0.354	6.146E-50	1558	0.343	0.169	Q386C9.pdb.gz	Q386C9_TRYB2 AMP deaminase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1340 PE=3 SV=1
11	PDB:3iarA	0.318	0.627	1.329E-9	360	0.080	0.169	3iarA.pdb.gz	The crystal structure of human adenosine deaminase
12	PDB:1a4lA	0.316	0.644	2.897E-9	349	0.083	0.183	1a4lA.pdb.gz	Complexes of adenosine deaminase with two potent inhibitors: X-ray structures in four independent molecules at pH of maximum activity.
13	PDB:3ou8B	0.315	0.702	5.022E-9	314	0.082	0.201	3ou8B.pdb.gz	The crystal structure of adenosine deaminase from Pseudomonas aeruginosa
14	PDB:6ijnA	0.306	0.624	1.301E-7	341	0.077	0.173	6ijnA.pdb.gz	Alternative conformation induced by substrate binding for Arabidopsis thalianaN6-methyl-AMP deaminase.
15	PDB:3ewdA	0.320	0.630	5.386E-7	364	0.078	0.165	3ewdA.pdb.gz	Structural and metabolic specificity of methylthiocoformycin for malarial adenosine deaminases.
16	PDB:6ii7A	0.312	0.616	6.774E-7	355	0.091	0.197	6ii7A.pdb.gz	Crystal structure of Plasmodium falciparum adenosine deaminase reveals a novel binding pocket for inosine.
17	PDB:2i2xA	0.190	0.283	5.401E-3	459	0.053	0.089	2i2xA.pdb.gz	Insight into the mechanism of biological methanol activation based on the crystal structure of the methanol-cobalamin methyltransferase complex
18	PDB:2xioA	0.210	0.455	2.136E-2	293	0.042	0.109	2xioA.pdb.gz
19	PDB:1odzA	0.141	0.248	2.813E-2	379	0.059	0.119	1odzA.pdb.gz	Expansion of the Glycosynthase Repertoire to Produce Defined Manno-Oligosaccharides
20	PDB:2uz9A	0.222	0.348	5.343E-2	444	0.076	0.131	2uz9A.pdb.gz	Human Guanine Deaminase (Guad) in Complex with Zinc and its Product Xhantine

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	D0IQK3	694	777	0.455	0.449	D0IQK3_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=2
2	H0Y360	780	836	0.525	0.482	H0Y360_HUMAN AMP deaminase OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2
3	M9MS55	690	789	0.455	0.442	M9MS55_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=1
4	O08739	1491	766	0.944	0.945	AMPD3_MOUSE AMP deaminase 3 OS=Mus musculus OX=10090 GN=Ampd3 PE=1 SV=2
5	O09178	1467	765	0.930	0.932	AMPD3_RAT AMP deaminase 3 OS=Rattus norvegicus OX=10116 GN=Ampd3 PE=1 SV=2
6	O80452	615	839	0.389	0.355	AMPD_ARATH AMP deaminase OS=Arabidopsis thaliana OX=3702 GN=AMPD PE=1 SV=2
7	P10759	926	747	0.589	0.605	AMPD1_RAT AMP deaminase 1 OS=Rattus norvegicus OX=10116 GN=Ampd1 PE=1 SV=1
8	P15274	575	810	0.381	0.360	AMPD_YEAST AMP deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AMD1 PE=1 SV=2
9	P23109	925	747	0.591	0.606	AMPD1_HUMAN AMP deaminase 1 OS=Homo sapiens OX=9606 GN=AMPD1 PE=1 SV=3
10	P50998	577	831	0.375	0.347	AMPD_SCHPO AMP deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ada1 PE=1 SV=3
11	Q01432	1603	767	1.000	1.000	AMPD3_HUMAN AMP deaminase 3 OS=Homo sapiens OX=9606 GN=AMPD3 PE=1 SV=1
12	Q01433	787	879	0.525	0.458	AMPD2_HUMAN AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=3
13	Q3V1D3	921	745	0.585	0.603	AMPD1_MOUSE AMP deaminase 1 OS=Mus musculus OX=10090 GN=Ampd1 PE=1 SV=2
14	Q54DD0	561	790	0.403	0.391	AMPD_DICDI AMP deaminase OS=Dictyostelium discoideum OX=44689 GN=amdA PE=1 SV=1
15	Q76NQ9	694	649	0.455	0.538	Q76NQ9_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=2
16	Q76NR0	697	774	0.455	0.451	Q76NR0_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=2
17	Q961Q7	692	707	0.468	0.508	Q961Q7_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=1
18	Q9DBT5	788	798	0.522	0.501	AMPD2_MOUSE AMP deaminase 2 OS=Mus musculus OX=10090 GN=Ampd2 PE=1 SV=2
19	Q9VY76	696	771	0.455	0.453	Q9VY76_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=4
20	X2JEY5	697	798	0.455	0.437	X2JEY5_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19326 AMP_deaminase	0	1124.3	AMP deaminase
2	PF00962 A_deaminase	8.7e-10	49.8	Adenosine deaminase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379802

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286621	0.972	Adenosine kinase
2	9606.ENSP00000485525	0.970	Adenylosuccinate lyase
3	9606.ENSP00000333019	0.968	Adenylosuccinate synthetase isozyme 1
4	9606.ENSP00000367615	0.964	Adenine phosphoribosyltransferase
5	9606.ENSP00000259727	0.963	GMP reductase 1
6	9606.ENSP00000355493	0.955	Adenylosuccinate synthetase isozyme 2
7	9606.ENSP00000321584	0.950	Inosine-5'-monophosphate dehydrogenase 2
8	9606.ENSP00000236959	0.943	Bifunctional purine biosynthesis protein PURH
9	9606.ENSP00000345096	0.943	Inosine-5'-monophosphate dehydrogenase 1
10	9606.ENSP00000369456	0.939	Inosine triphosphate pyrophosphatase
11	9606.ENSP00000298556	0.929	Hypoxanthine-guanine phosphoribosyltransferase
12	9606.ENSP00000360561	0.929	Ectonucleoside triphosphate diphosphohydrolase 8
13	9606.ENSP00000301825	0.918	Ectonucleoside triphosphate diphosphohydrolase 3
14	9606.ENSP00000354238	0.917	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
15	9606.ENSP00000371230	0.917	GTP:AMP phosphotransferase AK3, mitochondrial
16	9606.ENSP00000406261	0.914	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
17	9606.ENSP00000360250	0.913	Ectonucleoside triphosphate diphosphohydrolase 1
18	9606.ENSP00000286648	0.907	Deoxycytidine kinase
19	9606.ENSP00000422375	0.900	U8 snoRNA-decapping enzyme
20	9606.ENSP00000430075	0.862	AMP deaminase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003876	1.000	AMP deaminase activity
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0055086	0.995	nucleobase-containing small molecule metabolic process
GO:0009123	0.989	nucleoside monophosphate metabolic process
GO:0006163	0.987	purine nucleotide metabolic process
GO:1901292	0.986	nucleoside phosphate catabolic process
GO:1901135	0.985	carbohydrate derivative metabolic process
GO:0009154	0.983	purine ribonucleotide catabolic process
GO:0009167	0.966	purine ribonucleoside monophosphate metabolic process
GO:0046033	0.941	AMP metabolic process
GO:1901576	0.687	organic substance biosynthetic process
GO:0044249	0.687	cellular biosynthetic process
GO:0034654	0.650	nucleobase-containing compound biosynthetic process
GO:1901293	0.593	nucleoside phosphate biosynthetic process
GO:0072522	0.564	purine-containing compound biosynthetic process
GO:0009165	0.422	nucleotide biosynthetic process
GO:0006164	0.380	purine nucleotide biosynthetic process
GO:1901137	0.355	carbohydrate derivative biosynthetic process
GO:0009156	0.355	ribonucleoside monophosphate biosynthetic process
GO:0009260	0.350	ribonucleotide biosynthetic process
GO:0009152	0.334	purine ribonucleotide biosynthetic process
GO:0009168	0.328	purine ribonucleoside monophosphate biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.886	organelle
GO:0043227	0.851	membrane-bounded organelle
GO:0043231	0.708	intracellular membrane-bounded organelle
GO:0070013	0.665	intracellular organelle lumen
GO:0031982	0.613	vesicle
GO:0005634	0.483	nucleus
GO:0005615	0.372	extracellular space
GO:0012505	0.327	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14777	1.000	AMP + H(+) + H2O = IMP + NH4(+)
EC:3.5.4.6	1.000	AMP deaminase.

[back to server]