StarFunc result for job id Q01433

User Input

>input (879 residues)
MRNRGQGLFRLRSRCFLHQSLPLGAGRRKGLDVAEPGPSRCRSDSPAVAAVVPAMASYPS
GSGKPKAKYPFKKRASLQASTAAPEARGGLGAPPLQSARSLPGPAPCLKHFPLDLRTSMD
GKCKEIAEELFTRSLAESELRSAPYEFPEESPIEQLEERRQRLERQISQDVKLEPDILLR
AKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDA
AKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSADAPVHPP
ALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRREPDEHCSEVELPYPDLQEFVADVN
VLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIH
ASSCMNQKHLLRFIKRAMKRHLEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHAD
RNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELR
LSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLP
LFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYL
YYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQ
YLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEY
SIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRV
GYRYETLCQELALITQAVQSEMLETIPEEAGITMSPGPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01433	1.000	1.000	0.000	879	1.000	1.000	Q01433.pdb.gz	AMPD2_HUMAN AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=3
2	AFDB:Q01432	0.740	0.845	2.840E-73	767	0.443	0.507	Q01432.pdb.gz	AMPD3_HUMAN AMP deaminase 3 OS=Homo sapiens OX=9606 GN=AMPD3 PE=1 SV=1
3	AFDB:P10759	0.722	0.847	1.905E-71	747	0.425	0.501	P10759.pdb.gz	AMPD1_RAT AMP deaminase 1 OS=Rattus norvegicus OX=10116 GN=Ampd1 PE=1 SV=1
4	AFDB:P15274	0.675	0.731	2.898E-66	810	0.396	0.430	P15274.pdb.gz	AMPD_YEAST AMP deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AMD1 PE=1 SV=2
5	AFDB:O80452	0.657	0.688	2.035E-64	839	0.405	0.424	O80452.pdb.gz	AMPD_ARATH AMP deaminase OS=Arabidopsis thaliana OX=3702 GN=AMPD PE=1 SV=2
6	AFDB:P50998	0.638	0.673	7.411E-62	831	0.391	0.414	P50998.pdb.gz	AMPD_SCHPO AMP deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ada1 PE=1 SV=3
7	AFDB:Q54DD0	0.656	0.728	3.201E-61	790	0.390	0.434	Q54DD0.pdb.gz	AMPD_DICDI AMP deaminase OS=Dictyostelium discoideum OX=44689 GN=amdA PE=1 SV=1
8	AFDB:Q386C9	0.610	0.348	3.823E-47	1558	0.282	0.159	Q386C9.pdb.gz	Q386C9_TRYB2 AMP deaminase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1340 PE=3 SV=1
9	AFDB:P40361	0.528	0.523	5.482E-33	888	0.203	0.200	P40361.pdb.gz	YJH0_YEAST Inactive deaminase YJL070C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YJL070C PE=1 SV=1
10	PDB:3ou8B	0.276	0.697	1.355E-9	314	0.069	0.194	3ou8B.pdb.gz	The crystal structure of adenosine deaminase from Pseudomonas aeruginosa
11	PDB:1a4lA	0.293	0.667	3.229E-9	349	0.072	0.181	1a4lA.pdb.gz	Complexes of adenosine deaminase with two potent inhibitors: X-ray structures in four independent molecules at pH of maximum activity.
12	PDB:3iarA	0.301	0.668	9.673E-9	360	0.065	0.158	3iarA.pdb.gz	The crystal structure of human adenosine deaminase
13	PDB:6ijnA	0.283	0.660	4.578E-8	341	0.075	0.194	6ijnA.pdb.gz	Alternative conformation induced by substrate binding for Arabidopsis thalianaN6-methyl-AMP deaminase.
14	PDB:6ii7A	0.237	0.495	7.231E-8	355	0.071	0.175	6ii7A.pdb.gz	Crystal structure of Plasmodium falciparum adenosine deaminase reveals a novel binding pocket for inosine.
15	PDB:3ewdA	0.279	0.626	1.073E-6	364	0.075	0.181	3ewdA.pdb.gz	Structural and metabolic specificity of methylthiocoformycin for malarial adenosine deaminases.
16	PDB:3g77A	0.213	0.393	1.068E-3	423	0.046	0.095	3g77A.pdb.gz	Bacterial cytosine deaminase mutants created by molecular engineering show improved 5-fluorocytosine-mediated cell killing in vitro and in vivo.
17	PDB:6ohbA	0.221	0.389	4.830E-3	435	0.058	0.117	6ohbA.pdb.gz	Structural Determinants for Substrate Selectivity in Guanine Deaminase Enzymes of the Amidohydrolase Superfamily.
18	PDB:2xioA	0.184	0.448	1.382E-2	293	0.033	0.099	2xioA.pdb.gz
19	PDB:3cuzA	0.136	0.200	1.515E-2	529	0.072	0.119	3cuzA.pdb.gz	Atomic resolution structures of Escherichia coli and Bacillus anthracis malate synthase A: comparison with isoform G and implications for structure-based drug discovery
20	AFDB:Q5U154	0.037	0.038	8.017E-1	855	0.055	0.056	Q5U154.pdb.gz	Q5U154_DROME RE01051p OS=Drosophila melanogaster OX=7227 GN=Sln PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	D0IQK3	859	777	0.501	0.566	D0IQK3_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=2
2	H0Y360	1707	836	0.939	0.987	H0Y360_HUMAN AMP deaminase OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2
3	M9MS55	854	789	0.497	0.554	M9MS55_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=1
4	O08739	776	766	0.458	0.526	AMPD3_MOUSE AMP deaminase 3 OS=Mus musculus OX=10090 GN=Ampd3 PE=1 SV=2
5	O09178	769	765	0.455	0.523	AMPD3_RAT AMP deaminase 3 OS=Rattus norvegicus OX=10116 GN=Ampd3 PE=1 SV=2
6	O80452	661	839	0.385	0.403	AMPD_ARATH AMP deaminase OS=Arabidopsis thaliana OX=3702 GN=AMPD PE=1 SV=2
7	P10759	735	747	0.410	0.482	AMPD1_RAT AMP deaminase 1 OS=Rattus norvegicus OX=10116 GN=Ampd1 PE=1 SV=1
8	P15274	644	810	0.373	0.405	AMPD_YEAST AMP deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AMD1 PE=1 SV=2
9	P23109	728	747	0.406	0.478	AMPD1_HUMAN AMP deaminase 1 OS=Homo sapiens OX=9606 GN=AMPD1 PE=1 SV=3
10	P50998	640	831	0.345	0.365	AMPD_SCHPO AMP deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ada1 PE=1 SV=3
11	Q01432	768	767	0.458	0.525	AMPD3_HUMAN AMP deaminase 3 OS=Homo sapiens OX=9606 GN=AMPD3 PE=1 SV=1
12	Q01433	1826	879	1.000	1.000	AMPD2_HUMAN AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=3
13	Q3V1D3	738	745	0.410	0.483	AMPD1_MOUSE AMP deaminase 1 OS=Mus musculus OX=10090 GN=Ampd1 PE=1 SV=2
14	Q54DD0	643	790	0.395	0.439	AMPD_DICDI AMP deaminase OS=Dictyostelium discoideum OX=44689 GN=amdA PE=1 SV=1
15	Q76NQ9	840	649	0.474	0.643	Q76NQ9_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=2
16	Q76NR0	858	774	0.497	0.565	Q76NR0_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=2
17	Q961Q7	845	707	0.480	0.597	Q961Q7_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=1
18	Q9DBT5	1613	798	0.884	0.974	AMPD2_MOUSE AMP deaminase 2 OS=Mus musculus OX=10090 GN=Ampd2 PE=1 SV=2
19	Q9VY76	857	771	0.497	0.567	Q9VY76_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=4
20	X2JEY5	863	798	0.515	0.568	X2JEY5_DROME AMP deaminase OS=Drosophila melanogaster OX=7227 GN=AMPdeam PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01979 Amidohydro_1	6.3e+02	11.0	Amidohydrolase family
2	PF19326 AMP_deaminase	0	1140.9	AMP deaminase
3	PF00962 A_deaminase	2.4e-05	35.2	Adenosine deaminase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256578

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286621	0.970	Adenosine kinase
2	9606.ENSP00000367615	0.967	Adenine phosphoribosyltransferase
3	9606.ENSP00000485525	0.956	Adenylosuccinate lyase
4	9606.ENSP00000321584	0.952	Inosine-5'-monophosphate dehydrogenase 2
5	9606.ENSP00000259727	0.951	GMP reductase 1
6	9606.ENSP00000406261	0.949	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
7	9606.ENSP00000345096	0.948	Inosine-5'-monophosphate dehydrogenase 1
8	9606.ENSP00000355493	0.946	Adenylosuccinate synthetase isozyme 2
9	9606.ENSP00000360250	0.944	Ectonucleoside triphosphate diphosphohydrolase 1
10	9606.ENSP00000333019	0.942	Adenylosuccinate synthetase isozyme 1
11	9606.ENSP00000354238	0.932	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
12	9606.ENSP00000298556	0.931	Hypoxanthine-guanine phosphoribosyltransferase
13	9606.ENSP00000369456	0.930	Inosine triphosphate pyrophosphatase
14	9606.ENSP00000360561	0.925	Ectonucleoside triphosphate diphosphohydrolase 8
15	9606.ENSP00000301825	0.921	Ectonucleoside triphosphate diphosphohydrolase 3
16	9606.ENSP00000371230	0.921	GTP:AMP phosphotransferase AK3, mitochondrial
17	9606.ENSP00000236959	0.918	Bifunctional purine biosynthesis protein PURH
18	9606.ENSP00000286648	0.912	Deoxycytidine kinase
19	9606.ENSP00000422375	0.900	U8 snoRNA-decapping enzyme
20	9606.ENSP00000430075	0.865	AMP deaminase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003876	1.000	AMP deaminase activity
GO:0042802	0.999	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0072521	0.987	purine-containing compound metabolic process
GO:0055086	0.985	nucleobase-containing small molecule metabolic process
GO:0009152	0.973	purine ribonucleotide biosynthetic process
GO:0009168	0.969	purine ribonucleoside monophosphate biosynthetic process
GO:0046040	0.949	IMP metabolic process
GO:0032501	0.828	multicellular organismal process
GO:0097009	0.725	energy homeostasis
GO:0009187	0.490	cyclic nucleotide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14777	1.000	AMP + H(+) + H2O = IMP + NH4(+)
EC:3.5.4.6	1.000	AMP deaminase.

[back to server]