StarFunc result for job id Q01449

User Input

>input (175 residues)
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01449	1.000	1.000	4.623E-28	175	1.000	1.000	Q01449.pdb.gz	MLRA_HUMAN Myosin regulatory light chain 2, atrial isoform OS=Homo sapiens OX=9606 GN=MYL7 PE=1 SV=1
2	AFDB:Q7T2Y1	0.841	0.855	2.565E-21	172	0.749	0.762	Q7T2Y1.pdb.gz
3	AFDB:Q02045	0.829	0.839	5.081E-19	173	0.577	0.584	Q02045.pdb.gz	MYL5_HUMAN Myosin light chain 5 OS=Homo sapiens OX=9606 GN=MYL5 PE=2 SV=1
4	AFDB:Q62082	0.519	0.458	2.456E-18	202	0.589	0.510	Q62082.pdb.gz	MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus OX=10090 GN=Myl10 PE=2 SV=1
5	AFDB:A0A060WU79	0.604	0.542	3.641E-18	200	0.577	0.505	A0A060WU79.pdb.gz	A0A060WU79_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039796001 PE=4 SV=1
6	AFDB:A7XZM2	0.796	0.818	4.074E-18	170	0.577	0.594	A7XZM2.pdb.gz	A7XZM2_ONCMY Fast myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
7	AFDB:P04466	0.838	0.866	6.761E-18	169	0.560	0.580	P04466.pdb.gz	MYL11_RAT Myosin regulatory light chain 11 OS=Rattus norvegicus OX=10116 GN=Myl11 PE=1 SV=2
8	AFDB:P08733	0.709	0.741	3.456E-17	166	0.571	0.602	P08733.pdb.gz	MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus OX=10116 GN=Myl2 PE=1 SV=2
9	AFDB:Q9BUA6	0.577	0.467	3.471E-16	226	0.583	0.451	Q9BUA6.pdb.gz	MYL10_HUMAN Myosin regulatory light chain 10 OS=Homo sapiens OX=9606 GN=MYL10 PE=1 SV=2
10	AFDB:A0A0G2JSW0	0.780	0.793	9.033E-16	172	0.486	0.494	A0A0G2JSW0.pdb.gz	A0A0G2JSW0_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12b PE=4 SV=2
11	PDB:7qioP	0.425	0.504	1.926E-11	143	0.486	0.594	7qioP.pdb.gz
12	PDB:5tbyE	0.496	0.527	3.020E-11	160	0.571	0.625	5tbyE.pdb.gz
13	PDB:7mf3D	0.747	0.817	9.305E-11	158	0.446	0.494	7mf3D.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
14	PDB:1i84U	0.661	0.812	1.165E-10	138	0.440	0.558	1i84U.pdb.gz
15	PDB:3wfnB	0.457	0.469	3.438E-7	169	0.280	0.290	3wfnB.pdb.gz
16	PDB:1ggzA	0.463	0.548	8.947E-7	144	0.274	0.333	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
17	PDB:3fwbA	0.342	0.382	2.081E-6	153	0.229	0.261	3fwbA.pdb.gz
18	PDB:5a2hA	0.481	0.561	2.328E-6	147	0.269	0.320	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
19	PDB:6xyrA	0.369	0.198	3.452E-6	348	0.280	0.141	6xyrA.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.
20	PDB:1a2xA	0.330	0.358	4.324E-6	158	0.229	0.253	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q01449	4.78e-129	360	175	1.000	1.000	MLRA_HUMAN Myosin regulatory light chain 2, atrial isoform OS=Homo sapiens OX=9606 GN=MYL7 PE=1 SV=1
2	Q9QVP4	6.20e-125	350	175	0.954	0.954	MLRA_MOUSE Myosin regulatory light chain 2, atrial isoform OS=Mus musculus OX=10090 GN=Myl7 PE=1 SV=1
3	Q801M3	1.25e-97	281	172	0.766	0.779	Q801M3_DANRE Myosin light chain 2 Mlc2a OS=Danio rerio OX=7955 GN=cmlc2 PE=1 SV=1
4	Q02045	3.79e-79	234	173	0.634	0.642	MYL5_HUMAN Myosin light chain 5 OS=Homo sapiens OX=9606 GN=MYL5 PE=2 SV=1
5	P02609	1.22e-74	223	168	0.566	0.589	MYL11_CHICK Myosin regulatory light chain 11 OS=Gallus gallus OX=9031 GN=MYL11 PE=1 SV=2
6	P10916	8.90e-73	218	166	0.577	0.608	MLRV_HUMAN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Homo sapiens OX=9606 GN=MYL2 PE=1 SV=3
7	P51667	1.13e-72	218	166	0.571	0.602	MLRV_MOUSE Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Mus musculus OX=10090 GN=Myl2 PE=1 SV=3
8	P08733	1.25e-72	218	166	0.571	0.602	MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus OX=10116 GN=Myl2 PE=1 SV=2
9	P04466	3.17e-72	217	169	0.577	0.598	MYL11_RAT Myosin regulatory light chain 11 OS=Rattus norvegicus OX=10116 GN=Myl11 PE=1 SV=2
10	Q62082	8.37e-72	217	202	0.606	0.525	MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus OX=10090 GN=Myl10 PE=2 SV=1
11	P97457	1.40e-71	215	169	0.566	0.586	MYL11_MOUSE Myosin regulatory light chain 11 OS=Mus musculus OX=10090 GN=Myl11 PE=1 SV=3
12	A7XZM2	2.30e-71	214	170	0.577	0.594	A7XZM2_ONCMY Fast myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
13	A7XZM0	4.15e-71	214	168	0.554	0.577	A7XZM0_ONCMY Slow myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
14	A0A060WU79	7.14e-71	214	200	0.554	0.485	A0A060WU79_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039796001 PE=4 SV=1
15	Q96A32	7.91e-71	213	169	0.549	0.568	MYL11_HUMAN Myosin regulatory light chain 11 OS=Homo sapiens OX=9606 GN=MYL11 PE=1 SV=1
16	O93409	8.93e-71	213	169	0.566	0.586	MLRSA_DANRE Myosin regulatory light chain 2, skeletal muscle isoform A OS=Danio rerio OX=7955 GN=mylpfa PE=1 SV=1
17	Q9I9H9	1.14e-68	207	170	0.554	0.571	Q9I9H9_ONCKI Myosin light chain 2 OS=Oncorhynchus kisutch OX=8019 PE=2 SV=1
18	A0A060WH27	5.68e-67	202	149	0.520	0.611	A0A060WH27_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00071433001 PE=4 SV=1
19	Q9BUA6	3.19e-65	201	226	0.594	0.460	MYL10_HUMAN Myosin regulatory light chain 10 OS=Homo sapiens OX=9606 GN=MYL10 PE=1 SV=2
20	A0A060XEV5	4.53e-63	193	149	0.486	0.570	A0A060XEV5_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00044007001 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06747 CHCH	18	16.8	CHCH domain
2	PF00036 EF-hand_1	6.6e-10	48.9	EF hand
3	PF13202 EF-hand_5	2e-05	35.0	EF hand
4	PF13405 EF-hand_6	3.3e-08	43.7	EF-hand domain
5	PF13499 EF-hand_7	1.4e-07	43.2	EF-hand domain pair
6	PF13833 EF-hand_8	6.6e-08	43.5	EF-hand domain pair
7	PF14658 EF-hand_9	1.6e+02	14.1	EF-hand domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004433

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000012211	0.948	Myosin, heavy chain 10, non-muscle
2	61853.ENSNLEP00000021963	0.944	Troponin T type 2 (cardiac)
3	61853.ENSNLEP00000000107	0.915	Uncharacterized protein
4	61853.ENSNLEP00000023255	0.911	Actin, gamma 1
5	61853.ENSNLEP00000006752	0.899	Myosin, heavy chain 14, non-muscle
6	61853.ENSNLEP00000017677	0.890	Myosin, heavy chain 9, non-muscle
7	61853.ENSNLEP00000017157	0.885	Rho-associated protein kinase
8	61853.ENSNLEP00000018999	0.864	Uncharacterized protein
9	61853.ENSNLEP00000000538	0.841	Myosin light chain kinase
10	61853.ENSNLEP00000005716	0.834	Myosin, light chain 4, alkali
11	61853.ENSNLEP00000006189	0.819	Protein phosphatase 1, regulatory subunit 12A
12	61853.ENSNLEP00000018303	0.816	Uncharacterized protein
13	61853.ENSNLEP00000007531	0.801	Myosin, light chain 3, alkali
14	61853.ENSNLEP00000013099	0.780	Protein phosphatase 1, regulatory subunit 12C
15	61853.ENSNLEP00000021985	0.780	Uncharacterized protein
16	61853.ENSNLEP00000023603	0.779	Myosin light chain 6
17	61853.ENSNLEP00000000244	0.776	Myosin, light chain 6B, alkali, smooth muscle and non-muscle
18	61853.ENSNLEP00000008317	0.776	Rho-associated, coiled-coil containing protein kinase 1
19	61853.ENSNLEP00000000534	0.772	NK2 homeobox 5
20	61853.ENSNLEP00000000256	0.769	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.532	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.991	multicellular organismal process
GO:0009987	0.989	cellular process
GO:0050789	0.986	regulation of biological process
GO:0032502	0.976	developmental process
GO:0048856	0.973	anatomical structure development
GO:0007275	0.884	multicellular organism development
GO:0051239	0.857	regulation of multicellular organismal process
GO:0044057	0.805	regulation of system process
GO:0048869	0.761	cellular developmental process
GO:0030154	0.754	cell differentiation
GO:0071840	0.741	cellular component organization or biogenesis
GO:0016043	0.731	cellular component organization
GO:0048513	0.712	animal organ development
GO:0009888	0.684	tissue development
GO:0050794	0.677	regulation of cellular process
GO:0048731	0.636	system development
GO:0007010	0.624	cytoskeleton organization
GO:0009653	0.608	anatomical structure morphogenesis
GO:0061061	0.578	muscle structure development
GO:0030029	0.504	actin filament-based process
GO:0048518	0.487	positive regulation of biological process
GO:0007507	0.485	heart development
GO:0003008	0.481	system process
GO:0060537	0.433	muscle tissue development
GO:0050896	0.328	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0099080	0.974	supramolecular complex
GO:0005829	0.973	cytosol
GO:0099512	0.964	supramolecular fiber
GO:0043292	0.939	contractile fiber
GO:0032991	0.899	protein-containing complex
GO:0030016	0.787	myofibril
GO:0030017	0.752	sarcomere
GO:0043227	0.736	membrane-bounded organelle
GO:0043231	0.607	intracellular membrane-bounded organelle
GO:0015629	0.456	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]