StarFunc result for job id Q01469

User Input

>input (135 residues)
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55052	0.994	0.994	1.816E-22	135	0.919	0.919	P55052.pdb.gz	FABP5_BOVIN Fatty acid-binding protein 5 OS=Bos taurus OX=9913 GN=FABP5 PE=1 SV=4
2	AFDB:P55053	0.987	0.987	2.604E-22	135	0.815	0.815	P55053.pdb.gz	FABP5_RAT Fatty acid-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Fabp5 PE=1 SV=3
3	PDB:5ur9F	0.947	0.927	3.408E-21	138	1.000	0.978	5ur9F.pdb.gz	The Antinociceptive Agent SBFI-26 Binds to Anandamide Transporters FABP5 and FABP7 at Two Different Sites.
4	PDB:4azqA	0.982	0.975	5.145E-21	136	0.807	0.801	4azqA.pdb.gz	Crystallographic Study of Fabp5 as an Intracellular Endocannabinoid Transporter.
5	AFDB:P02689	0.959	0.980	1.430E-17	132	0.548	0.561	P02689.pdb.gz	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
6	AFDB:F1MHQ4	0.964	0.985	3.259E-17	132	0.526	0.538	F1MHQ4.pdb.gz	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
7	AFDB:O97788	0.965	0.986	3.803E-17	132	0.519	0.530	O97788.pdb.gz	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
8	AFDB:A0A0K0MJN3	0.964	0.986	4.216E-17	132	0.526	0.538	A0A0K0MJN3.pdb.gz	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
9	AFDB:P04117	0.963	0.984	5.179E-17	132	0.511	0.523	P04117.pdb.gz	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
10	AFDB:P07483	0.967	0.981	5.179E-17	133	0.489	0.496	P07483.pdb.gz	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
11	AFDB:P24526	0.958	0.980	8.232E-17	132	0.519	0.530	P24526.pdb.gz	MYP2_MOUSE Myelin P2 protein OS=Mus musculus OX=10090 GN=Pmp2 PE=2 SV=2
12	PDB:3nr3A	0.967	0.967	9.585E-17	135	0.548	0.548	3nr3A.pdb.gz
13	AFDB:P05413	0.967	0.982	1.180E-16	133	0.481	0.489	P05413.pdb.gz	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
14	PDB:5hz9A	0.958	0.958	1.971E-16	135	0.481	0.481	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
15	PDB:3p6dA	0.945	0.918	2.184E-16	139	0.511	0.496	3p6dA.pdb.gz	Structural analysis of ibuprofen binding to human adipocyte fatty-acid binding protein (FABP4).
16	PDB:2qm9A	0.951	0.924	3.132E-16	139	0.511	0.496	2qm9A.pdb.gz	Structural Basis for Activation of Fatty Acid-binding Protein 4
17	PDB:7yf1A	0.955	0.969	5.518E-16	133	0.452	0.459	7yf1A.pdb.gz
18	PDB:4a60A	0.938	0.899	1.257E-15	141	0.489	0.468	4a60A.pdb.gz
19	PDB:5bvsA	0.931	0.952	7.238E-15	132	0.526	0.538	5bvsA.pdb.gz	Structural basis for the ligand-binding specificity of fatty acid-binding proteins (pFABP4 and pFABP5) in gentoo penguin
20	PDB:7e25A	0.949	0.922	7.620E-15	139	0.437	0.424	7e25A.pdb.gz	Crystal structure of human brain-type fatty acid-binding protein FABP7 complexed with palmitic acid.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q01469	4.08e-97	276	135	1.000	1.000	FABP5_HUMAN Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3
2	P55052	1.40e-89	258	135	0.919	0.919	FABP5_BOVIN Fatty acid-binding protein 5 OS=Bos taurus OX=9913 GN=FABP5 PE=1 SV=4
3	Q05816	1.17e-81	238	135	0.800	0.800	FABP5_MOUSE Fatty acid-binding protein 5 OS=Mus musculus OX=10090 GN=Fabp5 PE=1 SV=3
4	P55053	1.71e-81	237	135	0.815	0.815	FABP5_RAT Fatty acid-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Fabp5 PE=1 SV=3
5	P02689	6.95e-49	154	132	0.548	0.561	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
6	P48035	1.08e-48	154	132	0.526	0.538	FABP4_BOVIN Fatty acid-binding protein, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=2 SV=2
7	F1MHQ4	1.46e-48	154	132	0.526	0.538	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
8	O97788	3.00e-47	150	132	0.519	0.530	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
9	P24526	4.21e-47	150	132	0.519	0.530	MYP2_MOUSE Myelin P2 protein OS=Mus musculus OX=10090 GN=Pmp2 PE=2 SV=2
10	A0A0K0MJN3	5.47e-47	150	132	0.526	0.538	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
11	Q0Z7S8	7.56e-46	147	132	0.496	0.508	FABP9_HUMAN Fatty acid-binding protein 9 OS=Homo sapiens OX=9606 GN=FABP9 PE=1 SV=1
12	P15090	7.64e-46	147	132	0.511	0.523	FABP4_HUMAN Fatty acid-binding protein, adipocyte OS=Homo sapiens OX=9606 GN=FABP4 PE=1 SV=3
13	P04117	6.89e-45	144	132	0.511	0.523	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
14	P07483	7.41e-43	139	133	0.489	0.496	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
15	A6NFH5	5.15e-42	137	140	0.489	0.471	FBP12_HUMAN Fatty acid-binding protein 12 OS=Homo sapiens OX=9606 GN=FABP12 PE=2 SV=2
16	P05413	2.73e-41	135	133	0.481	0.489	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
17	P70623	2.83e-41	135	132	0.467	0.477	FABP4_RAT Fatty acid-binding protein, adipocyte OS=Rattus norvegicus OX=10116 GN=Fabp4 PE=1 SV=3
18	P11404	8.25e-40	132	133	0.452	0.459	FABPH_MOUSE Fatty acid-binding protein, heart OS=Mus musculus OX=10090 GN=Fabp3 PE=1 SV=5
19	P55054	2.76e-38	128	132	0.430	0.439	FABP9_RAT Fatty acid-binding protein 9 OS=Rattus norvegicus OX=10116 GN=Fabp9 PE=1 SV=1
20	Q66I80	3.02e-38	128	134	0.474	0.478	Q66I80_DANRE Fatty acid binding protein 11a OS=Danio rerio OX=7955 GN=fabp11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00061 Lipocalin	3.7e-16	71.1	Lipocalin / cytosolic fatty-acid binding protein family
2	PF14651 Lipocalin_7	0.21	22.9	Lipocalin / cytosolic fatty-acid binding protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297258

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310928	0.925	Peroxisome proliferator-activated receptor delta
2	9606.ENSP00000357712	0.911	S100 calcium binding protein A7
3	9606.ENSP00000377494	0.906	Transgelin-3
4	9606.ENSP00000244289	0.882	Hormone-sensitive lipase
5	9606.ENSP00000245206	0.830	Aspartate aminotransferase, mitochondrial
6	9606.ENSP00000243167	0.820	Fatty-acid amide hydrolase 1
7	9606.ENSP00000439012	0.809	Acyl-CoA-binding protein
8	9606.ENSP00000370373	0.794	Peptidyl-prolyl cis-trans isomerase FKBP1B
9	9606.ENSP00000383003	0.794	Peptidyl-prolyl cis-trans isomerase FKBP1A
10	9606.ENSP00000287820	0.764	Peroxisome proliferator-activated receptor gamma
11	9606.ENSP00000432282	0.757	Transgelin
12	9606.ENSP00000285930	0.742	Aldose reductase
13	9606.ENSP00000234590	0.726	Alpha-enolase
14	9606.ENSP00000324105	0.721	Beta-enolase
15	9606.ENSP00000295834	0.719	Fatty acid-binding protein, liver
16	9606.ENSP00000419692	0.713	Retinoic acid receptor RXR-alpha
17	9606.ENSP00000304229	0.712	Histidine triad nucleotide-binding protein 1
18	9606.ENSP00000478474	0.708	NEDD8-conjugating enzyme UBE2F
19	9606.ENSP00000437402	0.700	Gamma-enolase
20	9606.ENSP00000359991	0.697	Phosphoglycerate mutase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005504	0.999	fatty acid binding
GO:0005515	0.995	protein binding
GO:0005501	0.555	retinoid binding
GO:0036041	0.407	long-chain fatty acid binding
GO:0097159	0.353	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.953	organic substance metabolic process
GO:0044238	0.950	primary metabolic process
GO:0009987	0.918	cellular process
GO:0044237	0.913	cellular metabolic process
GO:0065007	0.700	biological regulation
GO:0006629	0.664	lipid metabolic process
GO:0050789	0.625	regulation of biological process
GO:0010876	0.621	lipid localization
GO:0050794	0.579	regulation of cellular process
GO:0032502	0.553	developmental process
GO:0032501	0.546	multicellular organismal process
GO:0050896	0.539	response to stimulus
GO:0006810	0.528	transport
GO:0071702	0.516	organic substance transport
GO:0044281	0.490	small molecule metabolic process
GO:0015711	0.476	organic anion transport
GO:0044255	0.451	cellular lipid metabolic process
GO:0048856	0.449	anatomical structure development
GO:0006869	0.445	lipid transport
GO:0015718	0.427	monocarboxylic acid transport
GO:0006807	0.422	nitrogen compound metabolic process
GO:0015908	0.417	fatty acid transport
GO:0019222	0.411	regulation of metabolic process
GO:0048518	0.410	positive regulation of biological process
GO:0048519	0.323	negative regulation of biological process
GO:1901564	0.320	organonitrogen compound metabolic process
GO:0019752	0.316	carboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0031974	0.991	membrane-enclosed lumen
GO:0005634	0.987	nucleus
GO:0005576	0.981	extracellular region
GO:0070013	0.961	intracellular organelle lumen
GO:0005829	0.932	cytosol
GO:0005615	0.904	extracellular space
GO:0005654	0.888	nucleoplasm
GO:0070062	0.843	extracellular exosome
GO:0016020	0.496	membrane
GO:0012505	0.435	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]