StarFunc result for job id Q01484

User Input

>input (1400 residues)
MMNEDAAQKSDSGEKFNGSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTC
NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEG
ANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVA
ILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIA
AHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGL
TPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDD
VTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY
GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVV
RCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISARE
GQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPL
HVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTK
QGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGAD
QDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVL
LQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMT
EVLDVSDEEGDDTMTGDGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLR
SFSSDRSHTLSHASYLRDSAVMDDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALS
SSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPM
VEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVE
IPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRIC
RIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQP
MHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRL
LCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYRE
IICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKP
IYVDCFGNLVPLTKSGQHHI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5E8K5	0.547	0.395	0.000	1961	0.719	0.513	G5E8K5.pdb.gz	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
2	AFDB:P16157	0.492	0.380	0.000	1881	0.591	0.440	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
3	AFDB:Q0KIE7	0.531	0.483	5.008E-101	1549	0.517	0.467	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
4	AFDB:P97582	0.583	0.958	1.849E-93	843	0.594	0.987	P97582.pdb.gz	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
5	AFDB:Q9NCP8	0.585	0.700	5.826E-90	1159	0.499	0.603	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
6	PDB:8cs9A	0.432	0.750	1.084E-64	796	0.379	0.666	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
7	AFDB:Q3KN55	0.368	0.734	3.982E-44	697	0.267	0.537	Q3KN55.pdb.gz	Q3KN55_DROME Ankyrin 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
8	AFDB:Q8N8A2	0.300	0.405	8.835E-40	993	0.179	0.253	Q8N8A2.pdb.gz	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
9	AFDB:O75179	0.306	0.174	3.540E-38	2603	0.226	0.122	O75179.pdb.gz	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
10	AFDB:A0A0G2K916	0.301	0.170	3.954E-37	2615	0.209	0.112	A0A0G2K916.pdb.gz	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1
11	AFDB:Q3UES3	0.143	0.162	3.584E-35	1166	0.194	0.232	Q3UES3.pdb.gz	TNKS2_MOUSE Poly [ADP-ribose] polymerase tankyrase-2 OS=Mus musculus OX=10090 GN=Tnks2 PE=2 SV=2
12	PDB:5vkqA	0.353	0.334	7.310E-31	1499	0.177	0.165	5vkqA.pdb.gz
13	PDB:4oauC	0.188	0.366	4.825E-11	692	0.067	0.136	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.149	0.873	1.738E-9	229	0.049	0.297	2dvwA.pdb.gz
15	PDB:6aunA	0.163	0.336	6.462E-9	618	0.057	0.129	6aunA.pdb.gz
16	PDB:6v9hC	0.155	0.743	1.314E-8	270	0.052	0.270	6v9hC.pdb.gz
17	PDB:1wg0A	0.137	0.654	2.402E-8	243	0.044	0.251	1wg0A.pdb.gz
18	PDB:6mwqA	0.117	0.318	1.186E-7	493	0.074	0.209	6mwqA.pdb.gz
19	PDB:6jd6B	0.107	0.758	9.973E-7	192	0.035	0.255	6jd6B.pdb.gz
20	PDB:6pqpA	0.121	0.260	1.760E-6	615	0.079	0.180	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WTF3	685	1643	0.224	0.191	A0A087WTF3_HUMAN Ankyrin 3 (Fragment) OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=1
2	A0A0G2JZ56	2861	4013	0.974	0.340	A0A0G2JZ56_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
3	A0A0G2K6R9	2912	3998	0.991	0.347	A0A0G2K6R9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
4	A0A0G2KAS9	2761	3980	0.944	0.332	A0A0G2KAS9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
5	A0A0G2KBB9	2727	4017	0.942	0.328	A0A0G2KBB9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
6	A0A5F9ZGS5	2717	1871	0.945	0.707	A0A5F9ZGS5_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
7	A0A5F9ZGS7	2838	1827	0.981	0.752	A0A5F9ZGS7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
8	A0A5F9ZGX3	2890	3972	0.982	0.346	A0A5F9ZGX3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
9	A0A5F9ZGX8	2731	1830	0.951	0.727	A0A5F9ZGX8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
10	A0A5F9ZGY1	2884	1887	1.000	0.742	A0A5F9ZGY1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
11	A0A5F9ZGY3	2783	3934	0.951	0.338	A0A5F9ZGY3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
12	A0A5F9ZGY4	2784	3848	0.951	0.346	A0A5F9ZGY4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZGZ1	2844	1943	0.981	0.707	A0A5F9ZGZ1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	A0A5F9ZGZ5	2782	3874	0.950	0.343	A0A5F9ZGZ5_HUMAN Ankyrin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A5F9ZH03	2130	1785	0.770	0.604	A0A5F9ZH03_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZH10	1143	1005	0.404	0.563	A0A5F9ZH10_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZH17	2177	1879	0.789	0.588	A0A5F9ZH17_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZH18	1188	1109	0.404	0.510	A0A5F9ZH18_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZH19	2760	3895	0.945	0.340	A0A5F9ZH19_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZH30	2784	3995	0.951	0.333	A0A5F9ZH30_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.3e-138	457.5	Ankyrin repeat
2	PF12796 Ank_2	9e-148	492.6	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	8.8e-114	368.3	Ankyrin repeat
4	PF13637 Ank_4	4.2e-126	421.1	Ankyrin repeats (many copies)
5	PF13857 Ank_5	6.9e-120	400.9	Ankyrin repeats (many copies)
6	PF02887 PK_C	0.00031	32.4	Pyruvate kinase, alpha/beta domain
7	PF05025 RbsD_FucU	4.6e+02	12.6	RbsD / FucU transport protein family
8	PF06128 Shigella_OspC	33	15.7	Shigella flexneri OspC protein
9	PF17809 UPA_2	1.9e-30	116.8	UPA domain
10	PF00791 ZU5	2.6e-38	141.4	ZU5 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000019830

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004432	0.947	Inositol 1,4,5-trisphosphate receptor, type 1
2	61853.ENSNLEP00000010258	0.934	Inositol 1,4,5-trisphosphate receptor, type 3
3	61853.ENSNLEP00000009818	0.926	GABA(A) receptor-associated protein
4	61853.ENSNLEP00000006493	0.922	Inositol 1,4,5-trisphosphate receptor, type 2
5	61853.ENSNLEP00000015448	0.921	Ankyrin 1, erythrocytic
6	61853.ENSNLEP00000017069	0.909	Spectrin, beta, non-erythrocytic 4
7	61853.ENSNLEP00000011144	0.882	Spectrin, beta, non-erythrocytic 1
8	61853.ENSNLEP00000012176	0.824	nudE neurodevelopment protein 1-like 1
9	61853.ENSNLEP00000017475	0.823	Neurofascin
10	61853.ENSNLEP00000017376	0.818	annotation not available
11	61853.ENSNLEP00000004277	0.817	T-cell lymphoma invasion and metastasis 1
12	61853.ENSNLEP00000012692	0.803	Dynactin 4 (p62)
13	61853.ENSNLEP00000021341	0.797	Uncharacterized protein
14	61853.ENSNLEP00000009838	0.748	Belongs to the SKP1 family.
15	61853.ENSNLEP00000006601	0.738	Sodium channel protein
16	61853.ENSNLEP00000003456	0.734	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
17	61853.ENSNLEP00000021518	0.734	Potassium inwardly-rectifying channel, subfamily J, member 11
18	61853.ENSNLEP00000010216	0.725	Neuronal cell adhesion molecule
19	61853.ENSNLEP00000008434	0.711	Erythrocyte membrane protein band 4.1-like 3
20	61853.ENSNLEP00000005882	0.710	Sigma non-opioid intracellular receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005200	1.000	structural constituent of cytoskeleton
GO:0019899	0.487	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007272	0.984	ensheathment of neurons
GO:0051597	0.980	response to methylmercury
GO:0045216	0.960	cell-cell junction organization
GO:0034329	0.927	cell junction assembly
GO:0042552	0.921	myelination
GO:0010927	0.915	cellular component assembly involved in morphogenesis
GO:0007043	0.903	cell-cell junction assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]