StarFunc result for job id Q01523

User Input

>input (94 residues)
MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQ
ARATCYCRTGRCATRESLSGVCEISGRLYRLCCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01523	1.000	1.000	2.392E-15	94	1.000	1.000	Q01523.pdb.gz	DEF5_HUMAN Defensin alpha 5 OS=Homo sapiens OX=9606 GN=DEFA5 PE=1 SV=1
2	AFDB:P59665	0.370	0.370	3.595E-6	94	0.489	0.489	P59665.pdb.gz	DEF1_HUMAN Neutrophil defensin 1 OS=Homo sapiens OX=9606 GN=DEFA1 PE=1 SV=1
3	AFDB:Q62715	0.386	0.386	4.354E-6	94	0.511	0.511	Q62715.pdb.gz	DEF2_RAT Neutrophil antibiotic peptide NP-2 OS=Rattus norvegicus OX=10116 GN=Defa PE=1 SV=1
4	AFDB:P01376	0.360	0.357	8.787E-6	95	0.479	0.474	P01376.pdb.gz	DEF3_RABIT Corticostatin-3 OS=Oryctolagus cuniculus OX=9986 PE=1 SV=2
5	AFDB:P11477	0.451	0.456	1.209E-5	93	0.362	0.366	P11477.pdb.gz	DEFA1_MOUSE Alpha-defensin 1 OS=Mus musculus OX=10090 GN=Defa1 PE=1 SV=2
6	AFDB:Q01524	0.357	0.337	2.440E-5	100	0.489	0.460	Q01524.pdb.gz	DEF6_HUMAN Defensin-6 OS=Homo sapiens OX=9606 GN=DEFA6 PE=1 SV=1
7	AFDB:P12838	0.490	0.476	5.250E-5	97	0.500	0.485	P12838.pdb.gz	DEF4_HUMAN Defensin alpha 4 OS=Homo sapiens OX=9606 GN=DEFA4 PE=1 SV=2
8	AFDB:P28312	0.385	0.389	8.208E-5	93	0.362	0.366	P28312.pdb.gz	DEFA5_MOUSE Alpha-defensin 5 OS=Mus musculus OX=10090 GN=Defa5 PE=1 SV=2
9	AFDB:Q62714	0.359	0.363	1.129E-4	93	0.372	0.376	Q62714.pdb.gz	DEF4_RAT Defensin alpha 4 OS=Rattus norvegicus OX=10116 GN=Np4 PE=1 SV=1
10	AFDB:P28309	0.466	0.470	2.006E-4	93	0.351	0.355	P28309.pdb.gz	DEFA2_MOUSE Alpha-defensin 2 OS=Mus musculus OX=10090 GN=Defa2 PE=1 SV=2
11	PDB:6cs9A	0.182	0.329	3.019	41	0.074	0.171	6cs9A.pdb.gz	Human beta-defensin 2 killsCandida albicansthrough phosphatidylinositol 4,5-bisphosphate-mediated membrane permeabilization.
12	PDB:4yc3A	0.148	0.053	5.716	295	0.064	0.020	4yc3A.pdb.gz
13	PDB:4ek6A	0.155	0.057	6.093	279	0.043	0.014	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
14	PDB:6q56A	0.146	0.065	6.922	234	0.053	0.021	6q56A.pdb.gz
15	PDB:7cztH	0.151	0.073	7.865	221	0.064	0.027	7cztH.pdb.gz
16	PDB:3tygL	0.150	0.079	8.383	207	0.032	0.014	3tygL.pdb.gz	A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
17	PDB:5ginE	0.147	0.073	8.383	227	0.053	0.022	5ginE.pdb.gz	Box C/D guide RNAs recognize a maximum of 10 nt of substrates
18	PDB:6de5A	0.174	0.076	8.383	246	0.085	0.033	6de5A.pdb.gz	Drugging the Folate Pathway in Mycobacterium tuberculosis: The Role of Multi-targeting Agents.
19	PDB:7d58N	0.119	0.086	8.383	136	0.170	0.118	7d58N.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q01523	1.18e-61	184	94	1.000	1.000	DEF5_HUMAN Defensin alpha 5 OS=Homo sapiens OX=9606 GN=DEFA5 PE=1 SV=1
2	P59665	6.86e-22	83.6	94	0.489	0.489	DEF1_HUMAN Neutrophil defensin 1 OS=Homo sapiens OX=9606 GN=DEFA1 PE=1 SV=1
3	P59666	9.01e-22	83.2	94	0.489	0.489	DEF3_HUMAN Neutrophil defensin 3 OS=Homo sapiens OX=9606 GN=DEFA3 PE=1 SV=1
4	Q01524	2.28e-20	80.1	100	0.489	0.460	DEF6_HUMAN Defensin-6 OS=Homo sapiens OX=9606 GN=DEFA6 PE=1 SV=1
5	Q62715	5.30e-20	79.0	94	0.511	0.511	DEF2_RAT Neutrophil antibiotic peptide NP-2 OS=Rattus norvegicus OX=10116 GN=Defa PE=1 SV=1
6	Q62714	3.19e-17	71.6	93	0.404	0.409	DEF4_RAT Defensin alpha 4 OS=Rattus norvegicus OX=10116 GN=Np4 PE=1 SV=1
7	P28310	8.77e-13	60.5	93	0.383	0.387	DEFA3_MOUSE Alpha-defensin 3 OS=Mus musculus OX=10090 GN=Defa3 PE=1 SV=2
8	P12838	1.81e-12	59.7	97	0.500	0.485	DEF4_HUMAN Defensin alpha 4 OS=Homo sapiens OX=9606 GN=DEFA4 PE=1 SV=2
9	P01376	1.84e-12	59.7	95	0.479	0.474	DEF3_RABIT Corticostatin-3 OS=Oryctolagus cuniculus OX=9986 PE=1 SV=2
10	P50704	2.05e-12	59.3	93	0.372	0.376	DEFA6_MOUSE Alpha-defensin 6/12 OS=Mus musculus OX=10090 GN=Defa6 PE=1 SV=2
11	Q5G865	2.09e-12	59.3	93	0.383	0.387	DFA24_MOUSE Alpha-defensin 24 OS=Mus musculus OX=10090 GN=Defa24 PE=3 SV=1
12	P28309	6.26e-12	58.2	93	0.362	0.366	DEFA2_MOUSE Alpha-defensin 2 OS=Mus musculus OX=10090 GN=Defa2 PE=1 SV=2
13	P11477	8.48e-12	57.8	93	0.362	0.366	DEFA1_MOUSE Alpha-defensin 1 OS=Mus musculus OX=10090 GN=Defa1 PE=1 SV=2
14	Q45VN2	3.68e-11	56.2	95	0.404	0.400	DFA20_MOUSE Alpha-defensin 20 OS=Mus musculus OX=10090 GN=Defa20 PE=3 SV=2
15	A6YB85	7.96e-11	55.5	98	0.489	0.469	DEFA1_HORSE Alpha-defensin 1 OS=Equus caballus OX=9796 GN=DEFA1 PE=1 SV=1
16	P28311	2.90e-10	53.9	92	0.372	0.380	DEFA4_MOUSE Defensin alpha 4 OS=Mus musculus OX=10090 GN=Defa4 PE=1 SV=4
17	P28312	3.60e-10	53.9	93	0.362	0.366	DEFA5_MOUSE Alpha-defensin 5 OS=Mus musculus OX=10090 GN=Defa5 PE=1 SV=2
18	P82271	5.73e-08	47.8	76	0.404	0.500	RTD1B_MACMU Rhesus theta defensin-1/2 subunit B OS=Macaca mulatta OX=9544 GN=RTD1B PE=1 SV=1
19	P82270	1.16e-07	47.0	76	0.394	0.487	RTD1A_MACMU Rhesus theta defensin-1/3 subunit A OS=Macaca mulatta OX=9544 GN=RTD1A PE=1 SV=1
20	Q70LV9	0.006	35.0	91	0.181	0.187	Q70LV9_MOUSE Cryptdin related sequence peptide OS=Mus musculus OX=10090 GN=Defa-rs4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00323 Defensin_1	1.2e-06	40.2	Mammalian defensin
2	PF00879 Defensin_propep	3.4e-21	86.6	Defensin propeptide

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329890

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000297439	0.967	Beta-defensin 1
2	9606.ENSP00000333234	0.948	Beta-defensin 108B
3	9606.ENSP00000383396	0.943	Beta-defensin 116
4	9606.ENSP00000371825	0.932	Beta-defensin 127
5	9606.ENSP00000371847	0.932	Beta-defensin 125
6	9606.ENSP00000326309	0.929	Beta-defensin 124
7	9606.ENSP00000297436	0.922	Defensin-6
8	9606.ENSP00000319126	0.920	Beta-defensin 112
9	9606.ENSP00000371835	0.918	Beta-defensin 126
10	9606.ENSP00000371643	0.917	Beta-defensin 135
11	9606.ENSP00000312702	0.915	Beta-defensin 114
12	9606.ENSP00000360190	0.914	Beta-defensin 110
13	9606.ENSP00000246105	0.913	Beta-defensin 129
14	9606.ENSP00000335382	0.913	Beta-defensin 128
15	9606.ENSP00000354280	0.907	Trypsin-3
16	9606.ENSP00000381703	0.904	Beta-defensin 113
17	9606.ENSP00000485444	0.904	Trypsin-2
18	9606.ENSP00000365486	0.901	Beta-defensin 123
19	9606.ENSP00000253381	0.900	Beta-defensin 118
20	9606.ENSP00000335538	0.900	Beta-defensin 131A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.991	cellular process
GO:0098542	0.985	defense response to other organism
GO:0042742	0.974	defense response to bacterium
GO:0006955	0.969	immune response
GO:0061844	0.961	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0001906	0.920	cell killing
GO:0031640	0.663	killing of cells of another organism
GO:0050830	0.608	defense response to Gram-positive bacterium
GO:0065007	0.594	biological regulation
GO:0050789	0.583	regulation of biological process
GO:0050829	0.456	defense response to Gram-negative bacterium
GO:0050794	0.312	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005737	0.999	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0070013	0.996	intracellular organelle lumen
GO:0005615	0.993	extracellular space
GO:0031982	0.989	vesicle
GO:0031410	0.975	cytoplasmic vesicle
GO:0005794	0.919	Golgi apparatus
GO:0060205	0.899	cytoplasmic vesicle lumen
GO:0099503	0.866	secretory vesicle
GO:0005796	0.865	Golgi lumen
GO:0030141	0.841	secretory granule
GO:0034774	0.671	secretory granule lumen
GO:0070062	0.374	extracellular exosome
GO:0030496	0.326	midbody

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]