StarFunc result for job id Q01638

User Input

>input (556 residues)
MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQ
ERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYS
TVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYT
CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFG
KGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQ
YDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLL
WRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIY
GRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILI
EMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSK
IPRKASSLTPLAAQKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01638	1.000	1.000	0.000	556	1.000	1.000	Q01638.pdb.gz	ILRL1_HUMAN Interleukin-1 receptor-like 1 OS=Homo sapiens OX=9606 GN=IL1RL1 PE=1 SV=4
2	AFDB:P14719	0.442	0.434	4.712E-90	567	0.669	0.656	P14719.pdb.gz	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2
3	AFDB:Q62611	0.460	0.453	1.035E-86	566	0.626	0.615	Q62611.pdb.gz	ILRL1_RAT Interleukin-1 receptor-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rl1 PE=2 SV=1
4	AFDB:P14778	0.356	0.350	9.848E-51	569	0.281	0.274	P14778.pdb.gz	IL1R1_HUMAN Interleukin-1 receptor type 1 OS=Homo sapiens OX=9606 GN=IL1R1 PE=1 SV=1
5	AFDB:Q02955	0.368	0.357	6.271E-50	576	0.275	0.266	Q02955.pdb.gz	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1
6	AFDB:S6EPL9	0.355	0.330	1.330E-49	602	0.268	0.248	S6EPL9.pdb.gz	S6EPL9_ONCMY ST2L protein OS=Oncorhynchus mykiss OX=8022 GN=IL1RL1 PE=3 SV=1
7	AFDB:P13504	0.374	0.362	3.557E-49	576	0.286	0.276	P13504.pdb.gz	IL1R1_MOUSE Interleukin-1 receptor type 1 OS=Mus musculus OX=10090 GN=Il1r1 PE=1 SV=1
8	AFDB:Q90874	0.355	0.356	3.205E-48	555	0.288	0.288	Q90874.pdb.gz	Q90874_CHICK IL-1 receptor I OS=Gallus gallus OX=9031 GN=IL-1 receptor I PE=2 SV=1
9	AFDB:Q9HB29	0.328	0.320	1.839E-46	575	0.266	0.257	Q9HB29.pdb.gz	ILRL2_HUMAN Interleukin-1 receptor-like 2 OS=Homo sapiens OX=9606 GN=IL1RL2 PE=1 SV=2
10	AFDB:Q9ERS7	0.338	0.328	2.318E-46	574	0.266	0.258	Q9ERS7.pdb.gz	ILRL2_MOUSE Interleukin-1 receptor-like 2 OS=Mus musculus OX=10090 GN=Il1rl2 PE=1 SV=1
11	PDB:6dldD	0.139	0.269	1.109E-12	269	0.101	0.208	6dldD.pdb.gz
12	PDB:1e07A	0.141	0.123	3.366E-11	642	0.099	0.086	1e07A.pdb.gz
13	PDB:6dlfA	0.127	0.274	4.243E-11	236	0.092	0.216	6dlfA.pdb.gz
14	PDB:5oj2B	0.148	0.131	2.271E-10	692	0.103	0.082	5oj2B.pdb.gz
15	PDB:2rcjC	0.183	0.192	2.434E-9	523	0.081	0.086	2rcjC.pdb.gz
16	PDB:3o3uN	0.149	0.144	2.733E-9	580	0.074	0.071	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
17	PDB:3j0aA	0.217	0.157	1.976E-7	797	0.070	0.049	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
18	PDB:1hzhH	0.131	0.151	2.351E-7	457	0.083	0.101	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
19	PDB:2jb5L	0.165	0.350	2.351E-7	211	0.067	0.175	2jb5L.pdb.gz	Fab Mor03268 Triggers Absorption Shift of a Diagnostic Dye Via Packaging in a Solvent-Shielded Fab Dimer Interface
20	PDB:1igtB	0.128	0.154	2.491E-7	444	0.067	0.083	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P14719	0.0	814	567	0.669	0.656	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2
2	Q01638	0.0	1168	556	1.000	1.000	ILRL1_HUMAN Interleukin-1 receptor-like 1 OS=Homo sapiens OX=9606 GN=IL1RL1 PE=1 SV=4
3	Q62611	0.0	772	566	0.640	0.629	ILRL1_RAT Interleukin-1 receptor-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rl1 PE=2 SV=1
4	P14778	2.83e-65	224	569	0.284	0.278	IL1R1_HUMAN Interleukin-1 receptor type 1 OS=Homo sapiens OX=9606 GN=IL1R1 PE=1 SV=1
5	Q90874	8.80e-65	223	555	0.290	0.290	Q90874_CHICK IL-1 receptor I OS=Gallus gallus OX=9031 GN=IL-1 receptor I PE=2 SV=1
6	P13504	2.28e-59	209	576	0.290	0.280	IL1R1_MOUSE Interleukin-1 receptor type 1 OS=Mus musculus OX=10090 GN=Il1r1 PE=1 SV=1
7	Q02955	9.60e-59	207	576	0.273	0.264	IL1R1_RAT Interleukin-1 receptor type 1 OS=Rattus norvegicus OX=10116 GN=Il1r1 PE=2 SV=1
8	Q9HB29	7.06e-55	196	575	0.259	0.250	ILRL2_HUMAN Interleukin-1 receptor-like 2 OS=Homo sapiens OX=9606 GN=IL1RL2 PE=1 SV=2
9	Q9ERS7	3.91e-54	194	574	0.266	0.258	ILRL2_MOUSE Interleukin-1 receptor-like 2 OS=Mus musculus OX=10090 GN=Il1rl2 PE=1 SV=1
10	Q8QFN4	4.91e-48	177	571	0.288	0.280	Q8QFN4_SALSA Interleukin-1 receptor type I OS=Salmo salar OX=8030 GN=IL-1RL PE=2 SV=1
11	Q13478	2.12e-46	172	541	0.255	0.262	IL18R_HUMAN Interleukin-18 receptor 1 OS=Homo sapiens OX=9606 GN=IL18R1 PE=1 SV=1
12	B6ZK77	2.50e-45	172	700	0.254	0.201	IRL1B_DANRE Interleukin-1 receptor accessory protein-like 1-B OS=Danio rerio OX=7955 GN=il1rapl1b PE=1 SV=1
13	S6EPL9	5.81e-45	169	602	0.272	0.251	S6EPL9_ONCMY ST2L protein OS=Oncorhynchus mykiss OX=8022 GN=IL1RL1 PE=3 SV=1
14	Q61098	3.00e-44	166	537	0.290	0.300	IL18R_MOUSE Interleukin-18 receptor 1 OS=Mus musculus OX=10090 GN=Il18r1 PE=1 SV=1
15	Q9NP60	5.80e-44	168	686	0.250	0.203	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1
16	M1ZJW4	3.14e-43	164	599	0.268	0.249	M1ZJW4_ONCMY Interleukin 1 receptor-like 1 (ST2L) OS=Oncorhynchus mykiss OX=8022 GN=IL1RL1 PE=2 SV=1
17	B6ZK78	1.23e-41	161	681	0.237	0.194	B6ZK78_DANRE Interleukin 1-receptor accessory protein-like 2 OS=Danio rerio OX=7955 GN=si:ch211-149o12.1 PE=2 SV=1
18	Q9NPH3	6.49e-41	157	570	0.263	0.256	IL1AP_HUMAN Interleukin-1 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL1RAP PE=1 SV=2
19	Q9NZN1	1.34e-39	155	696	0.239	0.191	IRPL1_HUMAN Interleukin-1 receptor accessory protein-like 1 OS=Homo sapiens OX=9606 GN=IL1RAPL1 PE=1 SV=2
20	P59824	2.74e-39	154	696	0.239	0.191	IRPL1_RAT Interleukin-1 receptor accessory protein-like 1 OS=Rattus norvegicus OX=10116 GN=Il1rapl1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10224 DUF2205	8.6e+02	11.5	Short coiled-coil protein
2	PF07679 I-set	1.6e-12	58.7	Immunoglobulin I-set domain
3	PF00047 ig	6.4e-11	53.6	Immunoglobulin domain
4	PF13895 Ig_2	6.5e-09	47.3	Immunoglobulin domain
5	PF13927 Ig_3	4.8e-15	67.2	Immunoglobulin domain
6	PF18452 Ig_6	0.0032	28.7	Immunoglobulin domain
7	PF01582 TIR	1.8e-37	140.4	TIR domain
8	PF13676 TIR_2	0.011	27.8	TIR domain
9	PF07686 V-set	0.016	26.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000233954

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370842	0.999	Interleukin-33
2	9606.ENSP00000314807	0.983	Interleukin 1 receptor accessory protein
3	9606.ENSP00000401399	0.938	Myeloid differentiation primary response protein MyD88
4	9606.ENSP00000358997	0.852	Interleukin-1 receptor-associated kinase 1
5	9606.ENSP00000390651	0.826	Interleukin-1 receptor-associated kinase 4
6	9606.ENSP00000433623	0.816	TNF receptor-associated factor 6
7	9606.ENSP00000214869	0.786	Transmembrane emp24 domain-containing protein 1
8	9606.ENSP00000339804	0.695	Thymic stromal lymphopoietin
9	9606.ENSP00000304915	0.693	Interleukin-13
10	9606.ENSP00000231454	0.688	Interleukin-5
11	9606.ENSP00000377724	0.681	ORM1-like protein 3
12	9606.ENSP00000415049	0.681	Gasdermin-B
13	9606.ENSP00000350198	0.642	Somatostatin receptor type 2
14	9606.ENSP00000263341	0.639	Interleukin-1 beta
15	9606.ENSP00000288167	0.636	Interleukin-17 receptor B
16	9606.ENSP00000231449	0.618	Interleukin-4
17	9606.ENSP00000368632	0.616	Trans-acting T-cell-specific transcription factor GATA-3
18	9606.ENSP00000369666	0.613	F-box/LRR-repeat protein 19
19	9606.ENSP00000306157	0.578	Interleukin-7 receptor subunit alpha
20	9606.ENSP00000259206	0.572	Interleukin-1 receptor antagonist protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity
GO:0005102	0.767	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0051716	0.997	cellular response to stimulus
GO:0023052	0.994	signaling
GO:0007154	0.994	cell communication
GO:0050794	0.993	regulation of cellular process
GO:0007165	0.972	signal transduction
GO:0048518	0.825	positive regulation of biological process
GO:0019222	0.679	regulation of metabolic process
GO:0060255	0.635	regulation of macromolecule metabolic process
GO:0048522	0.634	positive regulation of cellular process
GO:0048583	0.588	regulation of response to stimulus
GO:0010468	0.564	regulation of gene expression
GO:0002376	0.530	immune system process
GO:0009893	0.512	positive regulation of metabolic process
GO:0001817	0.479	regulation of cytokine production
GO:0001819	0.472	positive regulation of cytokine production
GO:0002682	0.448	regulation of immune system process
GO:0042221	0.440	response to chemical
GO:0048519	0.427	negative regulation of biological process
GO:0007166	0.389	cell surface receptor signaling pathway
GO:0010033	0.387	response to organic substance
GO:0002684	0.386	positive regulation of immune system process
GO:0070887	0.385	cellular response to chemical stimulus
GO:0006950	0.382	response to stress
GO:0048584	0.367	positive regulation of response to stimulus
GO:0009605	0.358	response to external stimulus
GO:0031323	0.353	regulation of cellular metabolic process
GO:0023051	0.317	regulation of signaling
GO:0006952	0.317	defense response
GO:0048523	0.314	negative regulation of cellular process
GO:0009966	0.313	regulation of signal transduction
GO:0080134	0.309	regulation of response to stress
GO:0031326	0.306	regulation of cellular biosynthetic process
GO:0071310	0.305	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.895	intracellular anatomical structure
GO:0005737	0.878	cytoplasm
GO:0005829	0.725	cytosol
GO:0043227	0.680	membrane-bounded organelle
GO:0005576	0.628	extracellular region
GO:0043231	0.484	intracellular membrane-bounded organelle
GO:0005615	0.448	extracellular space
GO:0030054	0.420	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]