StarFunc result for job id Q01664

User Input

>input (338 residues)
MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRR
MQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQEL
SGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLE
AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAP
PPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKP
VRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01664	1.000	1.000	1.913E-50	338	1.000	1.000	Q01664.pdb.gz	TFAP4_HUMAN Transcription factor AP-4 OS=Homo sapiens OX=9606 GN=TFAP4 PE=1 SV=2
2	AFDB:Q8NDY6	0.229	0.326	9.535E-3	225	0.095	0.142	Q8NDY6.pdb.gz	BHE23_HUMAN Class E basic helix-loop-helix protein 23 OS=Homo sapiens OX=9606 GN=BHLHE23 PE=1 SV=1
3	AFDB:Q86VH2	0.163	0.063	1.099E-2	1401	0.124	0.030	Q86VH2.pdb.gz	KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens OX=9606 GN=KIF27 PE=1 SV=1
4	AFDB:A8IQT2	0.178	0.114	1.360E-2	576	0.142	0.083	A8IQT2.pdb.gz	CCD40_CHLRE Coiled-coil domain-containing protein 40 homolog OS=Chlamydomonas reinhardtii OX=3055 GN=CCDC40 PE=1 SV=1
5	AFDB:Q10207	0.146	0.092	1.683E-2	584	0.124	0.072	Q10207.pdb.gz	YBX1_SCHPO Uncharacterized protein C17D1.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC17D1.01 PE=4 SV=2
6	AFDB:A0A0R4IFA2	0.159	0.159	1.940E-2	336	0.139	0.140	A0A0R4IFA2.pdb.gz
7	AFDB:Q7M6Z4	0.181	0.053	2.236E-2	1394	0.151	0.037	Q7M6Z4.pdb.gz	KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus OX=10090 GN=Kif27 PE=1 SV=1
8	AFDB:Q57UR3	0.113	0.058	2.768E-2	934	0.180	0.065	Q57UR3.pdb.gz	Q57UR3_TRYB2 C2H2-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.110 PE=3 SV=1
9	AFDB:Q90477	0.212	0.255	3.677E-2	275	0.157	0.193	Q90477.pdb.gz	MYOD1_DANRE Myoblast determination protein 1 homolog OS=Danio rerio OX=7955 GN=myod1 PE=1 SV=2
10	AFDB:Q15007	0.160	0.141	6.046E-2	396	0.186	0.159	Q15007.pdb.gz	FL2D_HUMAN Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2
11	PDB:7suk5	0.152	0.168	4.364E-1	296	0.050	0.057	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
12	PDB:5n9jU	0.096	0.153	1.180	198	0.065	0.111	5n9jU.pdb.gz
13	PDB:3ojaA	0.159	0.115	1.267	482	0.062	0.044	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
14	PDB:2b76C	0.091	0.203	1.940	130	0.050	0.131	2b76C.pdb.gz	Fumarate Reductase and Succinate Oxidase Activity of Escherichia coli Complex II Homologs Are Perturbed Differently by Mutation of the Flavin Binding Domain
15	PDB:2bskD	0.101	0.317	2.236	90	0.053	0.200	2bskD.pdb.gz
16	PDB:6asyA	0.107	0.063	2.578	606	0.021	0.012	6asyA.pdb.gz	Conformation transitions of the polypeptide-binding pocket support an active substrate release from Hsp70s.
17	PDB:6mzcK	0.083	0.127	2.767	202	0.047	0.079	6mzcK.pdb.gz
18	PDB:1c1kA	0.099	0.142	2.971	217	0.038	0.060	1c1kA.pdb.gz
19	PDB:7qooK	0.125	0.158	3.947	253	0.065	0.087	7qooK.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
20	PDB:6lo8E	0.106	0.341	4.238	80	0.033	0.138	6lo8E.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q01664	0.0	683	338	1.000	1.000	TFAP4_HUMAN Transcription factor AP-4 OS=Homo sapiens OX=9606 GN=TFAP4 PE=1 SV=2
2	Q8BWA4	0.0	655	334	0.964	0.976	Q8BWA4_MOUSE BHLH domain-containing protein OS=Mus musculus OX=10090 GN=Tfap4 PE=2 SV=1
3	Q9JIZ5	0.0	665	338	0.976	0.976	Q9JIZ5_MOUSE Activator protein 4 OS=Mus musculus OX=10090 GN=Tfap4 PE=1 SV=1
4	A0A2R8VI80	3.44e-143	405	214	0.601	0.949	A0A2R8VI80_MOUSE Transcription factor AP4 (Fragment) OS=Mus musculus OX=10090 GN=Tfap4 PE=1 SV=1
5	A0A2R8W6R9	5.19e-139	394	199	0.580	0.985	A0A2R8W6R9_MOUSE Transcription factor AP4 (Fragment) OS=Mus musculus OX=10090 GN=Tfap4 PE=1 SV=1
6	Q9V406	1.35e-29	121	631	0.234	0.125	Q9V406_DROME Activator protein 4 OS=Drosophila melanogaster OX=7227 GN=crp PE=1 SV=1
7	Q86PC0	6.85e-29	118	543	0.234	0.145	Q86PC0_DROME RE01132p OS=Drosophila melanogaster OX=7227 GN=crp PE=2 SV=1
8	P34474	1.82e-19	90.9	431	0.186	0.146	HLH11_CAEEL Helix-loop-helix protein 11 OS=Caenorhabditis elegans OX=6239 GN=hlh-11 PE=1 SV=3
9	D2CLZ9	9.08e-07	52.0	266	0.074	0.094	ATOH8_DANRE Transcription factor atoh8 OS=Danio rerio OX=7955 GN=atoh8 PE=2 SV=1
10	Q10574	1.12e-06	49.7	142	0.074	0.176	LIN32_CAEEL Protein lin-32 OS=Caenorhabditis elegans OX=6239 GN=lin-32 PE=1 SV=2
11	Q99NA2	4.71e-06	50.1	322	0.071	0.075	ATOH8_MOUSE Transcription factor Atoh8 OS=Mus musculus OX=10090 GN=Atoh8 PE=1 SV=1
12	Q96SQ7	6.10e-06	49.7	321	0.071	0.075	ATOH8_HUMAN Transcription factor ATOH8 OS=Homo sapiens OX=9606 GN=ATOH8 PE=1 SV=2
13	O13125	7.05e-06	47.4	138	0.071	0.174	ATO7A_XENLA Transcription factor Atoh7-a OS=Xenopus laevis OX=8355 GN=atoh7-a PE=1 SV=1
14	A0A0C4DG26	1.27e-05	49.3	721	0.095	0.044	A0A0C4DG26_HUMAN HCG18989, isoform CRA_h OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
15	Q9NP71	1.30e-05	49.3	852	0.095	0.038	MLXPL_HUMAN Carbohydrate-responsive element-binding protein OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
16	O55208	1.71e-05	47.4	194	0.077	0.134	FIGLA_MOUSE Factor in the germline alpha OS=Mus musculus OX=10090 GN=Figla PE=2 SV=1
17	O57598	3.12e-05	45.8	151	0.086	0.192	ATOH7_CHICK Transcription factor ATOH7 OS=Gallus gallus OX=9031 GN=ATOH7 PE=1 SV=2
18	A6XLD8	5.29e-05	47.4	1105	0.118	0.036	A6XLD8_DANRE Sterol regulatory element binding transcription factor 1 OS=Danio rerio OX=7955 GN=SREBF1 PE=2 SV=1
19	Q9GQP6	5.95e-05	46.2	254	0.142	0.189	Q9GQP6_DROME BHLHZip transcription factor BIGMAX OS=Drosophila melanogaster OX=7227 GN=bigmax PE=2 SV=1
20	Q9D030	6.63e-05	45.1	160	0.077	0.163	TWST2_MOUSE Twist-related protein 2 OS=Mus musculus OX=10090 GN=Twist2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16423 COE1_HLH	3.9	18.6	Transcription factor COE1 helix-loop-helix domain
2	PF00010 HLH	3.6e-13	60.6	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000204517

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230056	0.929	Geminin
2	9606.ENSP00000384849	0.856	Cyclin-dependent kinase inhibitor 1
3	9606.ENSP00000307208	0.847	Nucleosome-remodeling factor subunit BPTF
4	9606.ENSP00000356811	0.740	HBS1-like protein
5	9606.ENSP00000355185	0.725	DNA cross-link repair 1A protein
6	9606.ENSP00000310515	0.720	Sperm protamine P1
7	9606.ENSP00000359206	0.692	F-box/WD repeat-containing protein 1A
8	9606.ENSP00000317123	0.679	U5 small nuclear ribonucleoprotein 200 kDa helicase
9	9606.ENSP00000265094	0.677	F-box/WD repeat-containing protein 11
10	9606.ENSP00000324693	0.648	Grainyhead-like protein 1 homolog
11	9606.ENSP00000411250	0.646	Next to BRCA1 gene 1 protein
12	9606.ENSP00000481357	0.643	C-C motif chemokine ligand 23
13	9606.ENSP00000369609	0.641	Hemoglobin subunit gamma-2
14	9606.ENSP00000327431	0.630	Hemoglobin subunit gamma 1
15	9606.ENSP00000339813	0.624	Protein-tyrosine sulfotransferase 2
16	9606.ENSP00000264010	0.603	Transcriptional repressor CTCF
17	9606.ENSP00000362649	0.577	Histone deacetylase 1
18	9606.ENSP00000222305	0.560	Upstream stimulatory factor 2
19	9606.ENSP00000266269	0.557	POZ-, AT hook-, and zinc finger-containing protein 1
20	9606.ENSP00000388940	0.547	Transcription factor 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0070888	0.996	E-box binding
GO:0019899	0.995	enzyme binding
GO:0042826	0.993	histone deacetylase binding
GO:0042802	0.925	identical protein binding
GO:0042803	0.921	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0006357	0.984	regulation of transcription by RNA polymerase II
GO:0045944	0.966	positive regulation of transcription by RNA polymerase II
GO:0065009	0.965	regulation of molecular function
GO:0050790	0.964	regulation of catalytic activity
GO:0044093	0.961	positive regulation of molecular function
GO:0051247	0.950	positive regulation of protein metabolic process
GO:0009987	0.949	cellular process
GO:0010950	0.935	positive regulation of endopeptidase activity
GO:2000116	0.891	regulation of cysteine-type endopeptidase activity
GO:2001056	0.855	positive regulation of cysteine-type endopeptidase activity
GO:0043280	0.847	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0048519	0.814	negative regulation of biological process
GO:0009892	0.772	negative regulation of metabolic process
GO:0048523	0.768	negative regulation of cellular process
GO:0010605	0.758	negative regulation of macromolecule metabolic process
GO:0051172	0.685	negative regulation of nitrogen compound metabolic process
GO:0010558	0.683	negative regulation of macromolecule biosynthetic process
GO:0045934	0.680	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.675	negative regulation of cellular biosynthetic process
GO:0051253	0.667	negative regulation of RNA metabolic process
GO:0045892	0.654	negative regulation of DNA-templated transcription
GO:0071840	0.573	cellular component organization or biogenesis
GO:0016043	0.561	cellular component organization
GO:0050896	0.537	response to stimulus
GO:0051716	0.326	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.992	cytoplasm
GO:0032991	0.985	protein-containing complex
GO:0005739	0.822	mitochondrion
GO:0005667	0.734	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]