StarFunc result for job id Q01668

User Input

>input (2161 residues)
MMMMMMMKKMQHQRQQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVS
GEGENRGCCGSLCQAISKSKLSRRWRRWNRFNRRRCRAAVKSVTFYWLVIVLVFLNTLTI
SSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGIT
ETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLF
IIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGG
PSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARK
ESLENKKNNKPEVNQIANSDNKVTIDDYREEDEDKDPYPPCDVPVGEEEEEEEEDEPEVP
AGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSS
AALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTFGAFLHKGAFCRNYFNLLDM
LVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMI
VTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDSPVVRERIWQNS
DFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPIYNHRVEISIFFIIYIIIVA
FFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWY
VVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILNMVFTGVFTVEMVLKVIAFK
PKGYFSDAWNTFDSLIVIGSIIDVALSEADPTESENVPVPTATPGNSEESNRISITFFRL
FRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDN
NQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYNPGEEYTCGSNFA
IVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKI
KTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFK
KRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEETKREEEDDVFK
RNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNH
HNHNSIGKQVPTSTNANLNNANMSKAAHGKRPSIGNLEHVSENGHHSSHKHDREPQRRSS
VKRTRYYETYIRSDSGDEQLPTICREDPEIHGYFRDPHCLGEQEYFSSEECYEDDSSPTW
SRQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRR
SSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRS
WATPPATPPYRDWTPCYTPLIQVEQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPAS
LTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEME
SAASTLLNGNVRPRANGDVGPLSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITT
L

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5gjwA	0.574	0.949	0.000	1291	0.461	0.772	5gjwA.pdb.gz	Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
2	PDB:7jpxA	0.509	0.981	0.000	1116	0.399	0.772	7jpxA.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.
3	PDB:7uhfA	0.556	0.971	0.000	1230	0.565	0.993	7uhfA.pdb.gz	Structural basis for pore blockade of human voltage-gated calcium channel Ca v 1.3 by motion sickness drug cinnarizine.
4	AFDB:A0A0R4IQX8	0.712	0.738	0.000	2082	0.749	0.777	A0A0R4IQX8.pdb.gz
5	AFDB:P27732	0.724	0.711	0.000	2203	0.959	0.941	P27732.pdb.gz	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2
6	AFDB:Q01668	1.000	1.000	0.000	2161	1.000	1.000	Q01668.pdb.gz	CAC1D_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1D OS=Homo sapiens OX=9606 GN=CACNA1D PE=1 SV=2
7	AFDB:Q5TZF1	0.694	0.683	0.000	2196	0.669	0.658	Q5TZF1.pdb.gz
8	AFDB:Q8MQA1	0.646	0.741	0.000	1877	0.471	0.542	Q8MQA1.pdb.gz	Q8MQA1_CAEEL Voltage-dependent L-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=egl-19 PE=1 SV=1
9	AFDB:Q99246	0.819	0.812	0.000	2179	0.968	0.960	Q99246.pdb.gz	CAC1D_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mus musculus OX=10090 GN=Cacna1d PE=1 SV=3
10	AFDB:Q9JIS7	0.661	0.718	0.000	1985	0.600	0.653	Q9JIS7.pdb.gz	CAC1F_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1F OS=Mus musculus OX=10090 GN=Cacna1f PE=1 SV=1
11	PDB:7mixA	0.555	0.890	1.356E-95	1326	0.317	0.517	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
12	PDB:7vfsA	0.542	0.910	2.394E-95	1266	0.303	0.517	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
13	PDB:3jbrA	0.451	0.767	5.487E-75	1224	0.390	0.689	3jbrA.pdb.gz
14	PDB:7w9lA	0.479	0.708	6.895E-60	1420	0.185	0.282	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
15	PDB:7xveA	0.455	0.749	5.086E-57	1276	0.173	0.292	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
16	PDB:7we4A	0.450	0.838	8.596E-57	1122	0.158	0.305	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
17	PDB:7wliA	0.460	0.855	6.152E-56	1135	0.178	0.338	7wliA.pdb.gz	Structure, gating, and pharmacology of human Ca V 3.3 channel.
18	AFDB:Q8CIR4	0.084	0.089	1.677E-5	2028	0.083	0.089	Q8CIR4.pdb.gz	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
19	AFDB:A0A096MKF8	0.055	0.054	3.377E-5	2190	0.130	0.129	A0A096MKF8.pdb.gz	A0A096MKF8_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1
20	AFDB:Q9BX84	0.086	0.090	7.751E-5	2022	0.068	0.072	Q9BX84.pdb.gz	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZMH8	1004	1960	0.244	0.269	A0A8I5ZMH8_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
2	A0A8I5ZS49	2341	1973	0.554	0.607	A0A8I5ZS49_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
3	A1XIQ4	2339	1980	0.554	0.605	A1XIQ4_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=2 SV=1
4	F8W3Z0	611	2280	0.160	0.152	F8W3Z0_DANRE Calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, b OS=Danio rerio OX=7955 GN=CACNA1Ab PE=2 SV=2
5	G3V9W8	2339	1980	0.554	0.605	G3V9W8_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
6	G5EFB0	1220	1523	0.328	0.465	G5EFB0_CAEEL EF-hand domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-2 PE=3 SV=2
7	G5EG02	1841	1783	0.466	0.565	G5EG02_CAEEL Voltage-dependent L-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=egl-19 PE=1 SV=1
8	O00555	644	2506	0.163	0.140	CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens OX=9606 GN=CACNA1A PE=1 SV=3
9	O35505	2725	2169	0.670	0.668	CAC1C_CAVPO Voltage-dependent L-type calcium channel subunit alpha-1C OS=Cavia porcellus OX=10141 GN=CACNA1C PE=1 SV=2
10	O55017	623	2327	0.163	0.151	CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus OX=10090 GN=Cacna1b PE=1 SV=1
11	O60840	2354	1977	0.551	0.602	CAC1F_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1F OS=Homo sapiens OX=9606 GN=CACNA1F PE=1 SV=2
12	O89089	622	2333	0.163	0.151	O89089_RAT Voltage-dependent N-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1b PE=1 SV=1
13	P07293	2271	1873	0.535	0.618	CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus OX=9986 GN=CACNA1S PE=1 SV=1
14	P15381	2746	2171	0.673	0.670	CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus OX=9986 GN=CACNA1C PE=1 SV=1
15	P22002	2633	2169	0.663	0.661	CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus OX=10116 GN=Cacna1c PE=1 SV=1
16	P27732	3997	2203	0.953	0.935	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2
17	P27884	641	2424	0.161	0.143	CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus OX=9986 GN=CACNA1A PE=1 SV=1
18	P54282	630	2212	0.161	0.157	CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus OX=10116 GN=Cacna1a PE=1 SV=1
19	P91645	1357	1851	0.352	0.411	CAC1A_DROME Voltage-dependent calcium channel type A subunit alpha-1 OS=Drosophila melanogaster OX=7227 GN=cac PE=1 SV=3
20	P97445	636	2368	0.161	0.147	CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus OX=10090 GN=Cacna1a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16885 CAC1F_C	1.4e-51	187.6	Voltage-gated calcium channel subunit alpha, C-term
2	PF08763 Ca_chan_IQ	1.2e-26	104.1	Voltage gated calcium channel IQ domain
3	PF16905 GPHH	1.2e-25	100.4	Voltage-dependent L-type calcium channel, IQ-associated
4	PF00520 Ion_trans	1.5e-254	851.4	Ion transport protein
5	PF08016 PKD_channel	7.7e-10	50.1	Polycystin cation channel
6	PF03248 Rer1	6.3e+02	11.5	Rer1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288139

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349320	0.989	Voltage-dependent calcium channel subunit alpha-2/delta-1
2	9606.ENSP00000301050	0.987	Voltage-dependent L-type calcium channel subunit beta-3
3	9606.ENSP00000320025	0.982	Voltage-dependent L-type calcium channel subunit beta-2
4	9606.ENSP00000266376	0.976	Voltage-dependent L-type calcium channel subunit alpha-1C
5	9606.ENSP00000377840	0.973	Voltage-dependent L-type calcium channel subunit beta-1
6	9606.ENSP00000226021	0.965	Voltage-dependent calcium channel gamma-1 subunit
7	9606.ENSP00000438949	0.965	Voltage-dependent L-type calcium channel subunit beta-4
8	9606.ENSP00000222812	0.964	Syntaxin-1A
9	9606.ENSP00000372169	0.963	Voltage-dependent calcium channel subunit alpha-2/delta-4
10	9606.ENSP00000270458	0.960	Voltage-dependent calcium channel gamma-8 subunit
11	9606.ENSP00000375647	0.960	Voltage-dependent calcium channel gamma-7 subunit
12	9606.ENSP00000262138	0.959	Voltage-dependent calcium channel gamma-4 subunit
13	9606.ENSP00000355192	0.952	Voltage-dependent L-type calcium channel subunit alpha-1S
14	9606.ENSP00000005284	0.949	Voltage-dependent calcium channel gamma-3 subunit
15	9606.ENSP00000418081	0.944	Voltage-dependent calcium channel subunit alpha-2/delta-2
16	9606.ENSP00000346265	0.936	Synaptotagmin-5
17	9606.ENSP00000380432	0.934	Insulin
18	9606.ENSP00000254976	0.931	Synaptosomal-associated protein 25
19	9606.ENSP00000362399	0.922	Syntaxin-binding protein 1
20	9606.ENSP00000314214	0.921	Vesicle-associated membrane protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008331	0.997	high voltage-gated calcium channel activity
GO:0008092	0.977	cytoskeletal protein binding
GO:0086007	0.471	voltage-gated calcium channel activity involved in cardiac muscle cell action potential
GO:0051393	0.466	alpha-actinin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0009987	0.987	cellular process
GO:0050789	0.984	regulation of biological process
GO:0032501	0.976	multicellular organismal process
GO:0050896	0.971	response to stimulus
GO:0003008	0.968	system process
GO:0006811	0.955	monoatomic ion transport
GO:0050794	0.952	regulation of cellular process
GO:0006816	0.945	calcium ion transport
GO:0042391	0.859	regulation of membrane potential
GO:0010959	0.845	regulation of metal ion transport
GO:0008016	0.843	regulation of heart contraction
GO:0034762	0.832	regulation of transmembrane transport
GO:1904062	0.820	regulation of monoatomic cation transmembrane transport
GO:0003012	0.819	muscle system process
GO:0001508	0.799	action potential
GO:0023052	0.767	signaling
GO:0007154	0.765	cell communication
GO:0051924	0.747	regulation of calcium ion transport
GO:0086065	0.739	cell communication involved in cardiac conduction
GO:0086001	0.711	cardiac muscle cell action potential
GO:0051899	0.696	membrane depolarization
GO:0050877	0.650	nervous system process
GO:0051716	0.478	cellular response to stimulus
GO:0007165	0.446	signal transduction
GO:0070509	0.432	calcium ion import
GO:0098662	0.424	inorganic cation transmembrane transport
GO:0034220	0.420	monoatomic ion transmembrane transport
GO:0098655	0.393	monoatomic cation transmembrane transport
GO:0048518	0.351	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098797	0.995	plasma membrane protein complex
GO:0034703	0.995	cation channel complex
GO:0005891	0.981	voltage-gated calcium channel complex
GO:0005622	0.680	intracellular anatomical structure
GO:0005737	0.670	cytoplasm
GO:0043227	0.621	membrane-bounded organelle
GO:0098590	0.601	plasma membrane region
GO:0042383	0.503	sarcolemma
GO:0045202	0.425	synapse
GO:0030315	0.328	T-tubule
GO:0043229	0.322	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]