StarFunc result for job id Q01718

User Input

>input (297 residues)
MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMY
FFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFS
LSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTS
LFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVL
LMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01718	1.000	1.000	8.692E-39	297	1.000	1.000	Q01718.pdb.gz	ACTHR_HUMAN Adrenocorticotropic hormone receptor OS=Homo sapiens OX=9606 GN=MC2R PE=1 SV=1
2	AFDB:A7Y4C2	0.880	0.858	1.062E-21	305	0.485	0.472	A7Y4C2.pdb.gz	A7Y4C2_ONCMY Putative melanocortin 2 receptor OS=Oncorhynchus mykiss OX=8022 GN=MC2R PE=2 SV=1
3	AFDB:P32244	0.876	0.807	1.162E-21	323	0.444	0.409	P32244.pdb.gz	MC3R_RAT Melanocortin receptor 3 OS=Rattus norvegicus OX=10116 GN=Mc3r PE=2 SV=2
4	AFDB:P41968	0.876	0.807	2.841E-21	323	0.444	0.409	P41968.pdb.gz	MC3R_HUMAN Melanocortin receptor 3 OS=Homo sapiens OX=9606 GN=MC3R PE=1 SV=3
5	AFDB:B0V1P1	0.878	0.802	2.971E-21	326	0.485	0.442	B0V1P1.pdb.gz	MC4R_DANRE Melanocortin receptor 4 OS=Danio rerio OX=7955 GN=mc4r PE=1 SV=1
6	AFDB:P35345	0.902	0.827	3.177E-20	325	0.475	0.434	P35345.pdb.gz	MC5R_RAT Melanocortin receptor 5 OS=Rattus norvegicus OX=10116 GN=Mc5r PE=2 SV=1
7	AFDB:F1Q9X5	0.847	0.828	4.345E-20	304	0.488	0.477	F1Q9X5.pdb.gz
8	AFDB:P33032	0.893	0.818	4.968E-20	325	0.458	0.418	P33032.pdb.gz	MC5R_HUMAN Melanocortin receptor 5 OS=Homo sapiens OX=9606 GN=MC5R PE=1 SV=3
9	AFDB:P32245	0.854	0.767	1.987E-19	332	0.461	0.413	P32245.pdb.gz	MC4R_HUMAN Melanocortin receptor 4 OS=Homo sapiens OX=9606 GN=MC4R PE=1 SV=2
10	PDB:7f53R	0.809	0.876	2.156E-19	273	0.461	0.502	7f53R.pdb.gz	Structural insights into ligand recognition and activation of the melanocortin-4 receptor.
11	AFDB:Q7ZTA3	0.852	0.786	2.717E-19	323	0.434	0.399	Q7ZTA3.pdb.gz	Q7ZTA3_DANRE Melanocyte-stimulating hormone receptor OS=Danio rerio OX=7955 GN=mc1r PE=2 SV=1
12	PDB:7f4fR	0.810	0.888	2.306E-16	269	0.377	0.416	7f4fR.pdb.gz	Structural mechanism of calcium-mediated hormone recognition and G beta interaction by the human melanocortin-1 receptor.
13	PDB:7td3R	0.733	0.744	1.233E-10	292	0.259	0.264	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
14	PDB:7wv9R	0.730	0.746	3.015E-10	290	0.253	0.259	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.
15	PDB:7td1R	0.722	0.731	9.640E-10	293	0.239	0.242	7td1R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
16	PDB:6iblA	0.725	0.555	1.153E-9	397	0.242	0.181	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
17	PDB:6gdgA	0.646	0.718	1.649E-9	264	0.253	0.284	6gdgA.pdb.gz	Cryo-EM structure of the adenosine A2Areceptor coupled to an engineered heterotrimeric G protein.
18	PDB:7xt8R	0.686	0.693	1.724E-9	294	0.253	0.255	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
19	PDB:7jvqR	0.705	0.729	5.513E-9	286	0.242	0.252	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	PDB:7e32R	0.684	0.711	6.028E-9	285	0.246	0.256	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V848	0.0	557	296	0.899	0.902	G3V848_RAT Adrenocorticotropic hormone receptor OS=Rattus norvegicus OX=10116 GN=Mc2r PE=3 SV=1
2	Q01718	0.0	604	297	1.000	1.000	ACTHR_HUMAN Adrenocorticotropic hormone receptor OS=Homo sapiens OX=9606 GN=MC2R PE=1 SV=1
3	B0V1P1	7.61e-97	290	326	0.492	0.448	MC4R_DANRE Melanocortin receptor 4 OS=Danio rerio OX=7955 GN=mc4r PE=1 SV=1
4	P35345	2.32e-93	281	325	0.475	0.434	MC5R_RAT Melanocortin receptor 5 OS=Rattus norvegicus OX=10116 GN=Mc5r PE=2 SV=1
5	Q7ZTA2	1.66e-92	278	304	0.475	0.464	Q7ZTA2_DANRE Adrenocorticotropic hormone receptor OS=Danio rerio OX=7955 GN=mc2r PE=3 SV=1
6	A7Y4C2	1.17e-91	276	305	0.492	0.479	A7Y4C2_ONCMY Putative melanocortin 2 receptor OS=Oncorhynchus mykiss OX=8022 GN=MC2R PE=2 SV=1
7	P70596	1.31e-91	277	332	0.478	0.428	MC4R_RAT Melanocortin receptor 4 OS=Rattus norvegicus OX=10116 GN=Mc4r PE=2 SV=1
8	P56450	3.83e-91	275	332	0.478	0.428	MC4R_MOUSE Melanocortin receptor 4 OS=Mus musculus OX=10090 GN=Mc4r PE=1 SV=3
9	P33032	5.35e-91	275	325	0.451	0.412	MC5R_HUMAN Melanocortin receptor 5 OS=Homo sapiens OX=9606 GN=MC5R PE=1 SV=3
10	P32245	8.57e-91	275	332	0.468	0.419	MC4R_HUMAN Melanocortin receptor 4 OS=Homo sapiens OX=9606 GN=MC4R PE=1 SV=2
11	P41968	6.61e-90	272	323	0.448	0.412	MC3R_HUMAN Melanocortin receptor 3 OS=Homo sapiens OX=9606 GN=MC3R PE=1 SV=3
12	P32244	4.99e-89	270	323	0.458	0.421	MC3R_RAT Melanocortin receptor 3 OS=Rattus norvegicus OX=10116 GN=Mc3r PE=2 SV=2
13	P33033	1.80e-88	268	323	0.465	0.427	MC3R_MOUSE Melanocortin receptor 3 OS=Mus musculus OX=10090 GN=Mc3r PE=2 SV=1
14	Q7ZTA3	7.68e-83	254	323	0.434	0.399	Q7ZTA3_DANRE Melanocyte-stimulating hormone receptor OS=Danio rerio OX=7955 GN=mc1r PE=2 SV=1
15	B6ZGR5	1.23e-71	225	317	0.391	0.366	B6ZGR5_RAT Melanocyte-stimulating hormone receptor OS=Rattus norvegicus OX=10116 GN=Mc1r PE=3 SV=1
16	Q01727	1.05e-69	220	315	0.387	0.365	MSHR_MOUSE Melanocyte-stimulating hormone receptor OS=Mus musculus OX=10090 GN=Mc1r PE=2 SV=2
17	Q01726	3.51e-69	219	317	0.387	0.363	MSHR_HUMAN Melanocyte-stimulating hormone receptor OS=Homo sapiens OX=9606 GN=MC1R PE=1 SV=2
18	A0A0B4J269	1.09e-63	216	797	0.387	0.144	A0A0B4J269_HUMAN G-protein coupled receptors family 1 profile domain-containing protein OS=Homo sapiens OX=9606 PE=1 SV=1
19	Q9DDK4	4.64e-24	102	362	0.303	0.249	S1PR1_DANRE Sphingosine 1-phosphate receptor 1 OS=Danio rerio OX=7955 GN=s1pr1 PE=2 SV=2
20	P48303	1.12e-22	98.6	383	0.283	0.219	S1PR1_RAT Sphingosine 1-phosphate receptor 1 OS=Rattus norvegicus OX=10116 GN=S1pr1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	6.8e-30	115.8	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	0.21	23.0	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	1.1e-09	49.6	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10328 7TM_GPCR_Srx	0.00026	32.3	Serpentine type 7TM GPCR chemoreceptor Srx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333821

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382684	0.998	Melanocortin-2 receptor accessory protein
2	9606.ENSP00000384092	0.998	Pro-opiomelanocortin
3	9606.ENSP00000257776	0.956	Melanocortin-2 receptor accessory protein 2
4	9606.ENSP00000360141	0.878	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
5	9606.ENSP00000292427	0.783	Cytochrome P450 11B1, mitochondrial
6	9606.ENSP00000276449	0.752	Steroidogenic acute regulatory protein, mitochondrial
7	9606.ENSP00000408860	0.734	Steroid 21-hydroxylase
8	9606.ENSP00000325822	0.726	Cytochrome P450 11B2, mitochondrial
9	9606.ENSP00000276571	0.725	Corticoliberin
10	9606.ENSP00000268053	0.720	Cholesterol side-chain cleavage enzyme, mitochondrial
11	9606.ENSP00000454804	0.696	Agouti-signaling protein
12	9606.ENSP00000342075	0.676	SUMO-interacting motif-containing protein 1
13	9606.ENSP00000387662	0.673	Glucagon
14	9606.ENSP00000358903	0.661	Steroid 17-alpha-hydroxylase/17,20 lyase
15	9606.ENSP00000381333	0.661	Corticotropin-releasing factor receptor 1
16	9606.ENSP00000364631	0.651	FYVE, RhoGEF and PH domain-containing protein 3
17	9606.ENSP00000362690	0.648	Steroidogenic factor 1
18	9606.ENSP00000316786	0.646	Corticosteroid 11-beta-dehydrogenase isozyme 2
19	9606.ENSP00000350005	0.644	Gastric inhibitory polypeptide
20	9606.ENSP00000462647	0.633	Pituitary adenylate cyclase-activating polypeptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0008528	1.000	G protein-coupled peptide receptor activity
GO:0005515	0.993	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.995	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0051716	0.981	cellular response to stimulus
GO:0023052	0.967	signaling
GO:0007154	0.967	cell communication
GO:0007186	0.961	G protein-coupled receptor signaling pathway
GO:0007188	0.951	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189	0.827	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0032501	0.562	multicellular organismal process
GO:0048856	0.379	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.993	intracellular anatomical structure
GO:0005737	0.940	cytoplasm
GO:0043226	0.638	organelle
GO:0043229	0.589	intracellular organelle
GO:0043231	0.491	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]