StarFunc result for job id Q01740

User Input

>input (532 residues)
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSA
VSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPD
IFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQ
NMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIR
PSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAH
LQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWF
GLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGK
WEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16549	0.998	0.998	0.000	532	0.880	0.880	P16549.pdb.gz	FMO1_PIG Flavin-containing monooxygenase 1 OS=Sus scrofa OX=9823 GN=FMO1 PE=1 SV=3
2	AFDB:P36365	0.995	0.995	0.000	532	0.823	0.823	P36365.pdb.gz	FMO1_RAT Flavin-containing monooxygenase 1 OS=Rattus norvegicus OX=10116 GN=Fmo1 PE=1 SV=2
3	AFDB:Q01740	1.000	1.000	0.000	532	1.000	1.000	Q01740.pdb.gz	FMO1_HUMAN Flavin-containing monooxygenase 1 OS=Homo sapiens OX=9606 GN=FMO1 PE=1 SV=3
4	AFDB:Q95LA2	0.995	0.995	0.000	532	0.885	0.885	Q95LA2.pdb.gz	FMO1_CANLF Flavin-containing monooxygenase 1 OS=Canis lupus familiaris OX=9615 GN=FMO1 PE=2 SV=3
5	AFDB:Q8K2I3	0.967	0.961	1.390E-83	535	0.560	0.557	Q8K2I3.pdb.gz	FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus OX=10090 GN=Fmo2 PE=1 SV=3
6	AFDB:Q99518	0.966	0.960	3.148E-83	535	0.570	0.566	Q99518.pdb.gz	FMO2_HUMAN Flavin-containing monooxygenase 2 OS=Homo sapiens OX=9606 GN=FMO2 PE=1 SV=5
7	AFDB:P31513	0.926	0.926	1.779E-79	532	0.547	0.547	P31513.pdb.gz	FMO3_HUMAN Flavin-containing monooxygenase 3 OS=Homo sapiens OX=9606 GN=FMO3 PE=1 SV=5
8	AFDB:Q9EQ76	0.930	0.931	6.061E-79	531	0.536	0.537	Q9EQ76.pdb.gz	FMO3_RAT Flavin-containing monooxygenase 3 OS=Rattus norvegicus OX=10116 GN=Fmo3 PE=1 SV=1
9	AFDB:P97872	0.944	0.942	2.625E-76	533	0.509	0.508	P97872.pdb.gz	FMO5_MOUSE Flavin-containing monooxygenase 5 OS=Mus musculus OX=10090 GN=Fmo5 PE=1 SV=4
10	AFDB:A0A024QYY6	0.931	0.929	4.188E-76	533	0.515	0.514	A0A024QYY6.pdb.gz
11	PDB:2xlrC	0.607	0.709	3.163E-30	452	0.211	0.248	2xlrC.pdb.gz	Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
12	PDB:2gv8A	0.608	0.725	2.062E-27	442	0.216	0.260	2gv8A.pdb.gz	Mechanism of action of a flavin-containing monooxygenase.
13	PDB:3uozA	0.543	0.535	2.984E-21	540	0.171	0.169	3uozA.pdb.gz	Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
14	PDB:4o5qA	0.326	0.332	2.089E-14	521	0.115	0.117	4o5qA.pdb.gz	Structure, mechanism and ensemble formation of the alkylhydroperoxide reductase subunits AhpC and AhpF from Escherichia coli
15	PDB:3s5wB	0.458	0.566	2.489E-14	414	0.137	0.176	3s5wB.pdb.gz	Two Structures of an N-Hydroxylating Flavoprotein Monooxygenase: ORNITHINE HYDROXYLASE FROM PSEUDOMONAS AERUGINOSA.
16	PDB:5xhuA	0.278	0.411	3.333E-14	329	0.126	0.204	5xhuA.pdb.gz	Crystal structure of ycgT from bacillus subtilis
17	PDB:3itjB	0.321	0.483	2.726E-13	319	0.113	0.188	3itjB.pdb.gz	Insights into the specificity of thioredoxin reductase-thioredoxin interactions. A structural and functional investigation of the yeast thioredoxin system.
18	PDB:1f6mA	0.416	0.647	3.443E-13	320	0.113	0.188	1f6mA.pdb.gz	Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
19	PDB:4b65A	0.448	0.510	4.610E-13	456	0.128	0.149	4b65A.pdb.gz	Structural Insight Into the Mechanism of Oxygen Activation and Substrate Selectivity of Flavin-Dependent N-Hydroxylating Monooxygenases.
20	PDB:2a87A	0.339	0.519	4.237E-12	313	0.107	0.182	2a87A.pdb.gz	Conformational flexibility of Mycobacterium tuberculosis thioredoxin reductase: crystal structure and normal-mode analysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16549	0.0	993	532	0.880	0.880	FMO1_PIG Flavin-containing monooxygenase 1 OS=Sus scrofa OX=9823 GN=FMO1 PE=1 SV=3
2	P31512	0.0	563	558	0.515	0.491	FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens OX=9606 GN=FMO4 PE=1 SV=3
3	P31513	0.0	595	532	0.547	0.547	FMO3_HUMAN Flavin-containing monooxygenase 3 OS=Homo sapiens OX=9606 GN=FMO3 PE=1 SV=5
4	P36365	0.0	934	532	0.823	0.823	FMO1_RAT Flavin-containing monooxygenase 1 OS=Rattus norvegicus OX=10116 GN=Fmo1 PE=1 SV=2
5	P36367	0.0	560	555	0.521	0.499	FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus OX=9986 GN=FMO4 PE=2 SV=2
6	P49326	0.0	559	533	0.513	0.512	FMO5_HUMAN Flavin-containing monooxygenase 5 OS=Homo sapiens OX=9606 GN=FMO5 PE=1 SV=2
7	P50285	0.0	942	532	0.833	0.833	FMO1_MOUSE Flavin-containing monooxygenase 1 OS=Mus musculus OX=10090 GN=Fmo1 PE=1 SV=1
8	P97872	0.0	568	533	0.511	0.510	FMO5_MOUSE Flavin-containing monooxygenase 5 OS=Mus musculus OX=10090 GN=Fmo5 PE=1 SV=4
9	Q01740	0.0	1107	532	1.000	1.000	FMO1_HUMAN Flavin-containing monooxygenase 1 OS=Homo sapiens OX=9606 GN=FMO1 PE=1 SV=3
10	Q8K2I3	0.0	659	535	0.562	0.559	FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus OX=10090 GN=Fmo2 PE=1 SV=3
11	Q8K4C0	0.0	578	533	0.509	0.508	FMO5_RAT Flavin-containing monooxygenase 5 OS=Rattus norvegicus OX=10116 GN=Fmo5 PE=1 SV=3
12	Q8VHG0	0.0	560	560	0.515	0.489	FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus OX=10090 GN=Fmo4 PE=1 SV=3
13	Q95LA2	0.0	975	532	0.885	0.885	FMO1_CANLF Flavin-containing monooxygenase 1 OS=Canis lupus familiaris OX=9615 GN=FMO1 PE=2 SV=3
14	Q99518	0.0	665	535	0.573	0.570	FMO2_HUMAN Flavin-containing monooxygenase 2 OS=Homo sapiens OX=9606 GN=FMO2 PE=1 SV=5
15	Q9EQ76	0.0	627	531	0.536	0.537	FMO3_RAT Flavin-containing monooxygenase 3 OS=Rattus norvegicus OX=10116 GN=Fmo3 PE=1 SV=1
16	G5EBJ9	7.75e-126	380	529	0.398	0.401	G5EBJ9_CAEEL Flavin-containing monooxygenase OS=Caenorhabditis elegans OX=6239 GN=fmo-2 PE=1 SV=1
17	Q7K3U4	6.55e-36	140	429	0.150	0.186	Q7K3U4_DROME Flavin-containing monooxygenase OS=Drosophila melanogaster OX=7227 GN=Fmo-2 PE=2 SV=1
18	Q9SS04	2.60e-31	128	459	0.207	0.240	GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana OX=3702 GN=FMOGS-OX1 PE=1 SV=1
19	Q9W1E9	2.14e-30	125	416	0.139	0.178	Q9W1E9_DROME Flavin-containing monooxygenase OS=Drosophila melanogaster OX=7227 GN=Fmo-1 PE=2 SV=1
20	Q6NZ32	2.59e-30	125	449	0.133	0.158	Q6NZ32_DANRE Flavin-containing monooxygenase OS=Danio rerio OX=7955 GN=sb:cb897 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	4.1e+02	11.7	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF01262 AlaDh_PNT_C	70	14.2	Alanine dehydrogenase/PNT, C-terminal domain
3	PF01266 DAO	0.074	24.2	FAD dependent oxidoreductase
4	PF00743 FMO-like	7.3e-296	993.3	Flavin-binding monooxygenase-like
5	PF13434 Lys_Orn_oxgnase	5.2e-07	40.7	L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase
6	PF13450 NAD_binding_8	0.15	23.7	NAD(P)-binding Rossmann-like domain
7	PF13454 NAD_binding_9	0.19	23.2	FAD-NAD(P)-binding
8	PF00070 Pyr_redox	0.46	22.3	Pyridine nucleotide-disulphide oxidoreductase
9	PF07992 Pyr_redox_2	1.6e-07	42.4	Pyridine nucleotide-disulphide oxidoreductase
10	PF13738 Pyr_redox_3	6e-16	70.2	Pyridine nucleotide-disulphide oxidoreductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481732

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353820	0.943	Cytochrome P450 2D6
2	9606.ENSP00000337915	0.942	Cytochrome P450 3A4
3	9606.ENSP00000260682	0.931	Cytochrome P450 2C9
4	9606.ENSP00000440689	0.685	Cytochrome P450 2E1
5	9606.ENSP00000013222	0.675	Indolethylamine N-methyltransferase
6	9606.ENSP00000264257	0.591	Interleukin-1 receptor-like 2
7	9606.ENSP00000420612	0.569	TCDD-inducible poly [ADP-ribose] polymerase
8	9606.ENSP00000480571	0.528	Cytochrome P450 3A7
9	9606.ENSP00000334246	0.523	Cytochrome P450 family 4 subfamily Z member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016709	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0005488	0.987	binding
GO:0005515	0.976	protein binding
GO:0004499	0.866	N,N-dimethylaniline monooxygenase activity
GO:0036094	0.465	small molecule binding
GO:0097159	0.452	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044281	0.993	small molecule metabolic process
GO:0044238	0.983	primary metabolic process
GO:0006807	0.976	nitrogen compound metabolic process
GO:1901564	0.970	organonitrogen compound metabolic process
GO:0006082	0.954	organic acid metabolic process
GO:1901360	0.883	organic cyclic compound metabolic process
GO:0046483	0.780	heterocycle metabolic process
GO:0034641	0.708	cellular nitrogen compound metabolic process
GO:0006725	0.663	cellular aromatic compound metabolic process
GO:0050896	0.602	response to stimulus
GO:0043436	0.587	oxoacid metabolic process
GO:0042221	0.526	response to chemical
GO:0051716	0.523	cellular response to stimulus
GO:0072524	0.521	pyridine-containing compound metabolic process
GO:0006805	0.475	xenobiotic metabolic process
GO:0065007	0.474	biological regulation
GO:0072521	0.415	purine-containing compound metabolic process
GO:0019637	0.411	organophosphate metabolic process
GO:0055086	0.405	nucleobase-containing small molecule metabolic process
GO:0006796	0.363	phosphate-containing compound metabolic process
GO:0009117	0.350	nucleotide metabolic process
GO:0019752	0.343	carboxylic acid metabolic process
GO:0016053	0.317	organic acid biosynthetic process
GO:0032787	0.310	monocarboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0016020	0.987	membrane
GO:0031090	0.963	organelle membrane
GO:0005789	0.883	endoplasmic reticulum membrane
GO:0031974	0.599	membrane-enclosed lumen
GO:0070013	0.542	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.13.-	1.000	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.
RHEA:24468	0.866	H(+) + N,N-dimethylaniline + NADPH + O2 = H2O + N,N-dimethylaniline N-oxide + NADP(+)
EC:1.14.13.8	0.866	flavin-containing monooxygenase.

[back to server]