StarFunc result for job id Q01780

User Input

>input (885 residues)
MAPPSTREPRVLSATSATKSDGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGDEY
DFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSNIKDRSKVTELEDKFDLLVDANDVI
LERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHAKNI
IRPQLKFREKIDNSNTPFLPKIFIKPNAQKPLPQALSKERRERPQDRPEDLDVPPALADF
IHQQRTQQVEQDMFAHPYQYELNHFTPADAVLQKPQPQLYRPIEETPCHFISSLDELVEL
NEKLLNCQEFAVDLEHHSYRSFLGLTCLMQISTRTEDFIIDTLELRSDMYILNESLTDPA
IVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLGRHSLDHLLKLYCNVDSNKQYQ
LADWRIRPLPEEMLSYARDDTHYLLYIYDKMRLEMWERGNGQPVQLQVVWQRSRDICLKK
FIKPIFTDESYLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMMLKI
AEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSGPLPSAE
RLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITL
FNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEI
SNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKR
ERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQF
DPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56960	0.483	0.482	0.000	887	0.873	0.871	P56960.pdb.gz	EXOSX_MOUSE Exosome complex component 10 OS=Mus musculus OX=10090 GN=Exosc10 PE=1 SV=2
2	AFDB:Q01780	1.000	1.000	0.000	885	1.000	1.000	Q01780.pdb.gz	EXOSX_HUMAN Exosome complex component 10 OS=Homo sapiens OX=9606 GN=EXOSC10 PE=1 SV=2
3	AFDB:G5EBX6	0.403	0.407	2.028E-48	876	0.282	0.285	G5EBX6.pdb.gz	EXOSX_CAEEL Exosome complex component 10 homolog OS=Caenorhabditis elegans OX=6239 GN=crn-3 PE=1 SV=1
4	AFDB:Q10146	0.510	0.577	6.010E-46	777	0.259	0.295	Q10146.pdb.gz	RRP6_SCHPO Exosome complex exonuclease rrp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp6 PE=3 SV=2
5	AFDB:Q581R8	0.490	0.582	1.514E-43	736	0.234	0.281	Q581R8.pdb.gz	Q581R8_TRYB2 Ribosomal RNA processing protein 6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.1050 PE=1 SV=1
6	AFDB:Q12149	0.477	0.572	1.128E-40	733	0.229	0.277	Q12149.pdb.gz	RRP6_YEAST Exosome complex exonuclease RRP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP6 PE=1 SV=1
7	PDB:5c0wK	0.465	0.699	5.210E-37	576	0.192	0.295	5c0wK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
8	AFDB:A9LLI8	0.380	0.377	7.433E-27	892	0.154	0.152	A9LLI8.pdb.gz	RP6L3_ARATH Protein RRP6-like 3 OS=Arabidopsis thaliana OX=3702 GN=RRP6L3 PE=2 SV=1
9	PDB:5c0xK	0.265	0.656	4.367E-26	350	0.132	0.334	5c0xK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
10	AFDB:Q8IKX8	0.389	0.307	3.597E-22	1136	0.118	0.092	Q8IKX8.pdb.gz	Q8IKX8_PLAF7 Exosome complex exonuclease RRP6 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1449700 PE=4 SV=1
11	PDB:6fszKK	0.268	0.550	3.177E-20	414	0.153	0.326	6fszKK.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
12	PDB:1yt3A	0.265	0.565	1.304E-17	375	0.082	0.195	1yt3A.pdb.gz	Crystal Structure of Escherichia coli RNase D, an Exoribonuclease Involved in Structured RNA Processing
13	PDB:7c4cA	0.183	0.449	7.874E-9	332	0.056	0.151	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.
14	PDB:1vk0A	0.154	0.546	3.411E-6	200	0.034	0.150	1vk0A.pdb.gz
15	PDB:5v5fA	0.161	0.606	1.253E-5	200	0.029	0.130	5v5fA.pdb.gz
16	PDB:2p51A	0.133	0.402	1.040E-2	255	0.029	0.102	2p51A.pdb.gz	The 1.4-A crystal structure of the S. pombe Pop2p deadenylase subunit unveils the configuration of an active enzyme
17	PDB:7v9mA	0.068	0.184	1.292E-2	224	0.024	0.094	7v9mA.pdb.gz	Constitutive signal bias mediated by the human GHRHR splice variant 1.
18	PDB:3v9xB	0.120	0.396	1.364E-2	212	0.029	0.123	3v9xB.pdb.gz	How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
19	AFDB:Q8CJ53	0.057	0.078	8.308E-2	603	0.088	0.129	Q8CJ53.pdb.gz	CIP4_MOUSE Cdc42-interacting protein 4 OS=Mus musculus OX=10090 GN=Trip10 PE=1 SV=2
20	AFDB:F4KD43	0.070	0.097	1.150E-1	590	0.079	0.119	F4KD43.pdb.gz	F4KD43_ARATH Cyclin family protein OS=Arabidopsis thaliana OX=3702 GN=CYCT1:5 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56960	0.0	1589	887	0.872	0.870	EXOSX_MOUSE Exosome complex component 10 OS=Mus musculus OX=10090 GN=Exosc10 PE=1 SV=2
2	Q01780	0.0	1840	885	1.000	1.000	EXOSX_HUMAN Exosome complex component 10 OS=Homo sapiens OX=9606 GN=EXOSC10 PE=1 SV=2
3	Q9VFF3	1.92e-147	460	900	0.280	0.276	Q9VFF3_DROME Rrp6, isoform B OS=Drosophila melanogaster OX=7227 GN=Rrp6 PE=1 SV=3
4	G5EBX6	2.26e-103	342	876	0.260	0.263	EXOSX_CAEEL Exosome complex component 10 homolog OS=Caenorhabditis elegans OX=6239 GN=crn-3 PE=1 SV=1
5	A9LLI7	3.27e-89	304	870	0.211	0.215	RP6L2_ARATH Protein RRP6-like 2 OS=Arabidopsis thaliana OX=3702 GN=RRP6L2 PE=2 SV=1
6	Q0WVE8	7.84e-86	289	637	0.168	0.234	RP6L1_ARATH Protein RRP6-like 1 OS=Arabidopsis thaliana OX=3702 GN=RRP6L1 PE=2 SV=1
7	F4HWX0	1.02e-85	289	639	0.168	0.233	F4HWX0_ARATH Polynucleotidyl transferase, ribonuclease H fold protein with HRDC domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=RRP6L1 PE=1 SV=1
8	Q10146	2.70e-81	280	777	0.197	0.224	RRP6_SCHPO Exosome complex exonuclease rrp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp6 PE=3 SV=2
9	Q12149	4.00e-81	279	733	0.216	0.261	RRP6_YEAST Exosome complex exonuclease RRP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP6 PE=1 SV=1
10	Q95Z10	6.41e-81	278	703	0.208	0.262	Q95Z10_9TRYP Rrp6p homologue OS=Trypanosoma brucei OX=5691 GN=RRP6 PE=4 SV=1
11	Q581R8	6.44e-81	278	736	0.212	0.255	Q581R8_TRYB2 Ribosomal RNA processing protein 6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.1050 PE=1 SV=1
12	A9LLI8	9.05e-51	195	892	0.140	0.139	RP6L3_ARATH Protein RRP6-like 3 OS=Arabidopsis thaliana OX=3702 GN=RRP6L3 PE=2 SV=1
13	Q8IKX8	9.85e-15	81.3	1136	0.066	0.051	Q8IKX8_PLAF7 Exosome complex exonuclease RRP6 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1449700 PE=4 SV=1
14	P09155	4.10e-11	68.2	375	0.079	0.187	RND_ECOLI Ribonuclease D OS=Escherichia coli (strain K12) OX=83333 GN=rnd PE=1 SV=1
15	O07183	4.43e-10	65.1	438	0.079	0.160	O07183_MYCTO Ribonuclease D, putative OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2755 PE=4 SV=1
16	Q8N9H8	6.26e-05	49.3	876	0.052	0.053	MUT7_HUMAN Exonuclease mut-7 homolog OS=Homo sapiens OX=9606 GN=EXD3 PE=1 SV=3
17	P92030	0.002	44.7	993	0.052	0.046	P92030_DROME Egalitarian OS=Drosophila melanogaster OX=7227 GN=egl PE=2 SV=2
18	Q7YU43	0.002	44.7	1004	0.052	0.046	Q7YU43_DROME RE33408p OS=Drosophila melanogaster OX=7227 GN=egl PE=2 SV=1
19	Q9W1K4	0.002	44.7	1004	0.052	0.046	Q9W1K4_DROME Egalitarian, isoform B OS=Drosophila melanogaster OX=7227 GN=egl PE=1 SV=4
20	F4I526	0.005	43.1	589	0.042	0.063	F4I526_ARATH Polynucleotidyl transferase, ribonuclease H-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ATRM2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01612 DNA_pol_A_exo1	6.4e-47	171.1	3'-5' exonuclease
2	PF00570 HRDC	2.4e-10	51.5	HRDC domain
3	PF08066 PMC2NT	5.8e-19	79.9	PMC2NT (NUC016) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366135

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221233	0.999	Exosome complex component RRP46
2	9606.ENSP00000230640	0.999	Superkiller viralicidic activity 2-like 2
3	9606.ENSP00000265564	0.999	Exosome complex component RRP42
4	9606.ENSP00000315476	0.999	Exosome complex component RRP41
5	9606.ENSP00000321711	0.999	DIS3-like exonuclease 1
6	9606.ENSP00000323046	0.999	Exosome complex component RRP40
7	9606.ENSP00000348107	0.999	Nuclear nucleic acid-binding protein C1D
8	9606.ENSP00000359939	0.999	Exosome complex component CSL4
9	9606.ENSP00000361433	0.999	Exosome complex component RRP4
10	9606.ENSP00000366997	0.999	Exosome complex exonuclease RRP44
11	9606.ENSP00000368984	0.999	Exosome complex component RRP45
12	9606.ENSP00000374354	0.999	Exosome complex component RRP43
13	9606.ENSP00000398597	0.999	Exosome complex component MTR3
14	9606.ENSP00000258169	0.995	M-phase phosphoprotein 6
15	9606.ENSP00000363642	0.994	Ribosome biogenesis protein BMS1 homolog
16	9606.ENSP00000454836	0.993	Transducin beta-like protein 3
17	9606.ENSP00000405068	0.992	Nucleolar protein 14
18	9606.ENSP00000221801	0.990	rRNA 2'-O-methyltransferase fibrillarin
19	9606.ENSP00000254803	0.990	Something about silencing protein 10
20	9606.ENSP00000377944	0.990	U3 small nucleolar RNA-associated protein 14 homolog A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0070034	1.000	telomerase RNA binding
GO:0000175	1.000	3'-5'-RNA exonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.996	regulation of biological process
GO:0071704	0.995	organic substance metabolic process
GO:0071840	0.991	cellular component organization or biogenesis
GO:0016070	0.986	RNA metabolic process
GO:0044260	0.980	cellular macromolecule metabolic process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0010468	0.973	regulation of gene expression
GO:0034660	0.960	ncRNA metabolic process
GO:0019219	0.951	regulation of nucleobase-containing compound metabolic process
GO:0010467	0.945	gene expression
GO:0044085	0.944	cellular component biogenesis
GO:0010605	0.929	negative regulation of macromolecule metabolic process
GO:0006396	0.925	RNA processing
GO:0010556	0.914	regulation of macromolecule biosynthetic process
GO:0031326	0.914	regulation of cellular biosynthetic process
GO:0034655	0.910	nucleobase-containing compound catabolic process
GO:0006401	0.900	RNA catabolic process
GO:0022613	0.872	ribonucleoprotein complex biogenesis
GO:0048523	0.825	negative regulation of cellular process
GO:0051172	0.822	negative regulation of nitrogen compound metabolic process
GO:0031324	0.808	negative regulation of cellular metabolic process
GO:0034661	0.794	ncRNA catabolic process
GO:0016072	0.779	rRNA metabolic process
GO:0071025	0.714	RNA surveillance
GO:0016071	0.713	mRNA metabolic process
GO:0033044	0.706	regulation of chromosome organization
GO:0032204	0.696	regulation of telomere maintenance
GO:0016043	0.626	cellular component organization
GO:1904356	0.626	regulation of telomere maintenance via telomere lengthening
GO:0034470	0.602	ncRNA processing
GO:0042254	0.523	ribosome biogenesis
GO:0010558	0.512	negative regulation of macromolecule biosynthetic process
GO:0031327	0.511	negative regulation of cellular biosynthetic process
GO:2000278	0.499	regulation of DNA biosynthetic process
GO:0010629	0.478	negative regulation of gene expression
GO:0071027	0.478	nuclear RNA surveillance
GO:0032210	0.475	regulation of telomere maintenance via telomerase
GO:0045934	0.435	negative regulation of nucleobase-containing compound metabolic process
GO:0006364	0.423	rRNA processing
GO:0051053	0.350	negative regulation of DNA metabolic process
GO:0000460	0.322	maturation of 5.8S rRNA
GO:0006402	0.313	mRNA catabolic process
GO:2001251	0.310	negative regulation of chromosome organization
GO:2000279	0.308	negative regulation of DNA biosynthetic process
GO:0048518	0.301	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005654	0.996	nucleoplasm
GO:0016020	0.983	membrane
GO:0005829	0.983	cytosol
GO:0032991	0.980	protein-containing complex
GO:0140513	0.863	nuclear protein-containing complex
GO:1902494	0.809	catalytic complex
GO:0005694	0.763	chromosome
GO:0000785	0.551	chromatin
GO:0000178	0.510	exosome (RNase complex)
GO:0000176	0.495	nuclear exosome (RNase complex)

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.13.-	1.000	Exoribonucleases producing 5'-phosphomonoesters.

[back to server]