StarFunc result for job id Q01804

User Input

>input (1114 residues)
MEAAVGVPDGGDQGGAGPREDATPMDAYLRKLGLYRKLVAKDGSCLFRAVAEQVLHSQSR
HVEVRMACIHYLRENREKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIY
REPNVSPSQVTENNFPEKVLLCFSNGNHYDIVYPIKYKESSAMCQSLLYELLYEKVFKTD
VSKIVMELDTLEVADEDNSEISDSEDDSCKSKTAAAAADVNGFKPLSGNEQLKNNGNSTS
LPLSRKVLKSLNPAVYRNVEYEIWLKSKQAQQKRDYSIAAGLQYEVGDKCQVRLDHNGKF
LNADVQGIHSENGPVLVEELGKKHTSKNLKAPPPESWNTVSGKKMKKPSTSGQNFHSDVD
YRGPKNPSKPIKAPSALPPRLQHPSGVRQHAFSSHSSGSQSQKFSSEHKNLSRTPSQIIR
KPDRERVEDFDHTSRESNYFGLSPEERREKQAIEESRLLYEIQNRDEQAFPALSSSSVNQ
SASQSSNPCVQRKSSHVGDRKGSRRRMDTEERKDKDSIHGHSQLDKRPEPSTLENITDDK
YATVSSPSKSKKLECPSPAEQKPAEHVSLSNPAPLLVSPEVHLTPAVPSLPATVPAWPSE
PTTFGPTGVPAPIPVLSVTQTLTTGPDSAVSQAHLTPSPVPVSIQAVNQPLMPLPQTLSL
YQDPLYPGFPCNEKGDRAIVPPYSLCQTGEDLPKDKNILRFFFNLGVKAYSCPMWAPHSY
LYPLHQAYLAACRMYPKVPVPVYPHNPWFQEAPAAQNESDCTCTDAHFPMQTEASVNGQM
PQPEIGPPTFSSPLVIPPSQVSESHGQLSYQADLESETPGQLLHADYEESLSGKNMFPQP
SFGPNPFLGPVPIAPPFFPHVWYGYPFQGFIENPVMRQNIVLPSDEKGELDLSLENLDLS
KDCGSVSTVDEFPEARGEHVHSLPEASVSSKPDEGRTEQSSQTRKADTALASIPPVAEGK
AHPPTQILNRERETVPVELEPKRTIQSLKEKTEKVKDPKTAADVVSPGANSVDSRVQRPK
EESSEDENEVSNILRSGRSKQFYNQTYGSRKYKSDWGYSGRGGYQHVRSEESWKGQPSRS
RDEGYQYHRNVRGRPFRGDRRRSGMGDGHRGQHT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RRE7	0.326	0.327	0.000	1107	0.873	0.878	B2RRE7.pdb.gz	OTUD4_MOUSE OTU domain-containing protein 4 OS=Mus musculus OX=10090 GN=Otud4 PE=1 SV=1
2	AFDB:Q01804	0.999	0.999	0.000	1114	1.000	1.000	Q01804.pdb.gz	OTUD4_HUMAN OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4
3	AFDB:F1QHE7	0.240	0.201	7.355E-40	1358	0.325	0.267	F1QHE7.pdb.gz
4	AFDB:E9QIU2	0.239	0.292	4.152E-34	889	0.232	0.291	E9QIU2.pdb.gz	E9QIU2_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=otul PE=4 SV=1
5	AFDB:F1QTC9	0.208	0.263	2.123E-32	859	0.230	0.298	F1QTC9.pdb.gz
6	AFDB:Q9NP73	0.241	0.236	1.476E-31	1137	0.232	0.227	Q9NP73.pdb.gz	ALG13_HUMAN Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Homo sapiens OX=9606 GN=ALG13 PE=1 SV=2
7	AFDB:Q9D8C3	0.229	0.220	1.947E-31	1166	0.229	0.219	Q9D8C3.pdb.gz	ALG13_MOUSE Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Mus musculus OX=10090 GN=Alg13 PE=1 SV=2
8	PDB:4ddgA	0.078	0.209	1.147E-3	399	0.023	0.065	4ddgA.pdb.gz
9	PDB:4fjvA	0.079	0.338	3.111E-3	231	0.020	0.095	4fjvA.pdb.gz	The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
10	PDB:4dhjA	0.079	0.333	4.338E-3	248	0.017	0.077	4dhjA.pdb.gz
11	AFDB:Q7LBC6	0.062	0.041	3.990E-2	1761	0.112	0.071	Q7LBC6.pdb.gz	KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2
12	AFDB:Q7TSH3	0.045	0.043	6.570E-2	1157	0.121	0.117	Q7TSH3.pdb.gz	ZN516_MOUSE Zinc finger protein 516 OS=Mus musculus OX=10090 GN=Znf516 PE=1 SV=1
13	AFDB:P93022	0.044	0.043	7.340E-2	1164	0.100	0.095	P93022.pdb.gz	ARFG_ARATH Auxin response factor 7 OS=Arabidopsis thaliana OX=3702 GN=ARF7 PE=1 SV=2
14	PDB:3mp8A	0.037	0.078	8.384E-1	513	0.010	0.021	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
15	PDB:7nkxZ	0.038	0.240	8.384E-1	156	0.008	0.058	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
16	PDB:4g97A	0.041	0.131	1.306	243	0.014	0.066	4g97A.pdb.gz	Crystal structure of the response regulator PhyR from Brucella abortus
17	PDB:7abi7	0.038	0.166	1.723	236	0.010	0.047	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
18	PDB:5b0oB	0.035	0.074	1.821	455	0.011	0.026	5b0oB.pdb.gz	Insight into the flagella type III export revealed by the complex structure of the type III ATPase and its regulator
19	PDB:4wvhA	0.025	0.052	2.540	519	0.008	0.017	4wvhA.pdb.gz	Peptide binding to a bacterial signal peptidase visualized by peptide tethering and carrier-driven crystallization.
20	PDB:2cghA	0.035	0.137	3.170	238	0.012	0.055	2cghA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RRE7	0.0	1943	1107	0.873	0.879	OTUD4_MOUSE OTU domain-containing protein 4 OS=Mus musculus OX=10090 GN=Otud4 PE=1 SV=1
2	Q01804	0.0	2303	1114	1.000	1.000	OTUD4_HUMAN OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4
3	A0A0R4IPL2	1.08e-85	298	854	0.171	0.222	A0A0R4IPL2_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=otul PE=4 SV=2
4	Q9NP73	5.95e-84	298	1137	0.171	0.168	ALG13_HUMAN Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Homo sapiens OX=9606 GN=ALG13 PE=1 SV=2
5	Q49HH8	7.64e-84	293	859	0.169	0.219	Q49HH8_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=otul PE=2 SV=1
6	E9QIU2	3.83e-82	289	889	0.171	0.214	E9QIU2_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=otul PE=4 SV=1
7	Q9D8C3	2.86e-74	270	1166	0.174	0.166	ALG13_MOUSE Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Mus musculus OX=10090 GN=Alg13 PE=1 SV=2
8	P10383	9.17e-41	165	853	0.096	0.125	OTU_DROME Protein ovarian tumor locus OS=Drosophila melanogaster OX=7227 GN=otu PE=2 SV=2
9	Q9XIP2	5.60e-13	75.1	505	0.036	0.079	OTU6_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 6 OS=Arabidopsis thaliana OX=3702 GN=OTU6 PE=1 SV=2
10	Q5VV17	1.35e-11	70.9	481	0.037	0.085	OTUD1_HUMAN OTU domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OTUD1 PE=1 SV=1
11	B1AZ99	1.95e-11	69.7	396	0.039	0.111	OTUD3_MOUSE OTU domain-containing protein 3 OS=Mus musculus OX=10090 GN=Otud3 PE=1 SV=1
12	Q3U2S4	3.47e-10	66.2	566	0.034	0.067	OTUD5_MOUSE OTU domain-containing protein 5 OS=Mus musculus OX=10090 GN=Otud5 PE=1 SV=2
13	Q96G74	1.15e-09	64.7	571	0.028	0.054	OTUD5_HUMAN OTU domain-containing protein 5 OS=Homo sapiens OX=9606 GN=OTUD5 PE=1 SV=1
14	Q9VTK7	1.15e-09	65.1	659	0.034	0.058	Q9VTK7_DROME Deubiquitinating enzyme A, isoform E OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=2
15	Q8IQF9	1.42e-09	64.3	499	0.034	0.076	Q8IQF9_DROME AT23158p OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=2
16	Q5T2D3	1.83e-09	63.5	398	0.047	0.131	OTUD3_HUMAN OTU domain-containing protein 3 OS=Homo sapiens OX=9606 GN=OTUD3 PE=1 SV=1
17	Q95S49	2.25e-09	63.9	568	0.034	0.067	Q95S49_DROME GM08907p OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=1
18	E1JIE7	2.31e-09	63.9	568	0.034	0.067	E1JIE7_DROME Deubiquitinating enzyme A, isoform G OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=1
19	Q9LPT6	5.79e-09	59.7	208	0.032	0.173	OTU2_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 2 OS=Arabidopsis thaliana OX=3702 GN=OTU2 PE=1 SV=1
20	Q9LYC7	7.10e-05	48.5	332	0.035	0.117	OTU5_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 5 OS=Arabidopsis thaliana OX=3702 GN=OTU5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02338 OTU	6.9e-12	57.4	OTU-like cysteine protease
2	PF10275 Peptidase_C65	7.5	17.5	Peptidase C65 Otubain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000016866

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000009178	0.739	Uncharacterized protein
2	9601.ENSPPYP00000023468	0.720	Regulator of chromosome condensation 2
3	9601.ENSPPYP00000004743	0.715	Poly (ADP-ribose) polymerase family, member 11
4	9601.ENSPPYP00000002170	0.714	KIAA2013
5	9601.ENSPPYP00000003658	0.710	Asparaginase like 1
6	9601.ENSPPYP00000008057	0.709	Pyridoxal-dependent decarboxylase domain containing 1
7	9601.ENSPPYP00000004533	0.655	Dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase)
8	9601.ENSPPYP00000003836	0.653	AlkB homolog 3, alpha-ketoglutaratedependent dioxygenase
9	9601.ENSPPYP00000007800	0.626	Sequence-specific RNA-binding protein that regulates mRNA cytoplasmic polyadenylation and translation initiation during oocyte maturation, early development and at postsynapse sites of neurons. Binds to the cytoplasmic polyadenylation element (CPE), an uridine-rich sequence element (consensus sequence 5'-UUUUUAU-3') within the mRNA 3'- UTR. In absence of phosphorylation and in association with TACC3 is also involved as a repressor of translation of CPE-containing mRNA
10	9601.ENSPPYP00000008002	0.615	Chitobiosyldiphosphodolichol beta-mannosyltransferase
11	9601.ENSPPYP00000005621	0.610	AlkB homolog 2, alpha-ketoglutarate dependent dioxygenase
12	9601.ENSPPYP00000011338	0.594	Nanos C2HC-type zinc finger 2
13	9601.ENSPPYP00000001315	0.551	ALG14, UDP-N-acetylglucosaminyltransferase subunit
14	9601.ENSPPYP00000002065	0.551	OTU deubiquitinase 3
15	9601.ENSPPYP00000019429	0.534	Ring finger protein 216
16	9601.ENSPPYP00000008014	0.522	Ubiquitin specific peptidase 7 (herpes virus-associated)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0061578	1.000	K63-linked deubiquitinase activity
GO:0004843	0.999	cysteine-type deubiquitinase activity
GO:0060090	0.997	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0016579	0.982	protein deubiquitination
GO:0048523	0.979	negative regulation of cellular process
GO:0009966	0.957	regulation of signal transduction
GO:0080134	0.951	regulation of response to stress
GO:0002831	0.950	regulation of response to biotic stimulus
GO:0050776	0.950	regulation of immune response
GO:0023057	0.947	negative regulation of signaling
GO:0060759	0.938	regulation of response to cytokine stimulus
GO:0048585	0.936	negative regulation of response to stimulus
GO:0045088	0.896	regulation of innate immune response
GO:0009968	0.889	negative regulation of signal transduction
GO:0001959	0.876	regulation of cytokine-mediated signaling pathway
GO:0060255	0.847	regulation of macromolecule metabolic process
GO:0051171	0.844	regulation of nitrogen compound metabolic process
GO:0080090	0.840	regulation of primary metabolic process
GO:0062207	0.819	regulation of pattern recognition receptor signaling pathway
GO:0031323	0.816	regulation of cellular metabolic process
GO:0060761	0.816	negative regulation of response to cytokine stimulus
GO:0048522	0.805	positive regulation of cellular process
GO:0001960	0.782	negative regulation of cytokine-mediated signaling pathway
GO:0002683	0.754	negative regulation of immune system process
GO:0019219	0.647	regulation of nucleobase-containing compound metabolic process
GO:0051246	0.612	regulation of protein metabolic process
GO:0010604	0.560	positive regulation of macromolecule metabolic process
GO:0051173	0.526	positive regulation of nitrogen compound metabolic process
GO:0070536	0.425	protein K63-linked deubiquitination
GO:0009987	0.406	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.949	intracellular membrane-bounded organelle
GO:0012505	0.596	endomembrane system
GO:0005634	0.493	nucleus
GO:0016020	0.379	membrane
GO:0070013	0.310	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	0.999	ubiquitinyl hydrolase 1.

[back to server]