StarFunc result for job id Q01813

User Input

>input (784 residues)
MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGIT
NLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMEC
VQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTK
RVLPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSICVL
GISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQ
PWSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4xyjA	0.965	0.985	0.000	768	0.980	1.000	4xyjA.pdb.gz	Structures of human phosphofructokinase-1 and atomic basis of cancer-associated mutations.
2	PDB:7lw1A	0.936	0.986	0.000	744	0.658	0.694	7lw1A.pdb.gz	Selective activation of PFKL suppresses the phagocytic oxidative burst.
3	AFDB:A0A060WI24	0.957	0.961	0.000	780	0.684	0.687	A0A060WI24.pdb.gz	A0A060WI24_ONCMY ATP-dependent 6-phosphofructokinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00075887001 PE=3 SV=1
4	AFDB:A0A060X7Z0	0.954	0.922	0.000	811	0.691	0.668	A0A060X7Z0.pdb.gz	A0A060X7Z0_ONCMY ATP-dependent 6-phosphofructokinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028237001 PE=3 SV=1
5	AFDB:P00511	0.955	0.960	0.000	780	0.696	0.700	P00511.pdb.gz	PFKAM_RABIT ATP-dependent 6-phosphofructokinase, muscle type OS=Oryctolagus cuniculus OX=9986 GN=PFKM PE=1 SV=3
6	AFDB:P12382	0.955	0.960	0.000	780	0.675	0.678	P12382.pdb.gz	PFKAL_MOUSE ATP-dependent 6-phosphofructokinase, liver type OS=Mus musculus OX=10090 GN=Pfkl PE=1 SV=4
7	AFDB:P47859	0.988	0.980	0.000	791	0.915	0.906	P47859.pdb.gz	PFKAP_RABIT ATP-dependent 6-phosphofructokinase, platelet type OS=Oryctolagus cuniculus OX=9986 GN=PFKP PE=1 SV=1
8	AFDB:P47860	0.994	0.989	0.000	788	0.883	0.878	P47860.pdb.gz	PFKAP_RAT ATP-dependent 6-phosphofructokinase, platelet type OS=Rattus norvegicus OX=10116 GN=Pfkp PE=1 SV=2
9	AFDB:P52034	0.966	0.961	0.000	788	0.582	0.579	P52034.pdb.gz	PFKA_DROME ATP-dependent 6-phosphofructokinase OS=Drosophila melanogaster OX=7227 GN=Pfk PE=2 SV=2
10	AFDB:Q8AYP9	0.954	0.971	0.000	770	0.656	0.668	Q8AYP9.pdb.gz	Q8AYP9_CHICK ATP-dependent 6-phosphofructokinase OS=Gallus gallus OX=9031 GN=pfk PE=2 SV=1
11	AFDB:Q90YA3	0.945	0.963	0.000	769	0.708	0.722	Q90YA3.pdb.gz	Q90YA3_CHICK ATP-dependent 6-phosphofructokinase OS=Gallus gallus OX=9031 GN=pfk PE=2 SV=1
12	PDB:3o8lA	0.932	0.976	1.224E-99	748	0.690	0.723	3o8lA.pdb.gz	The Crystal Structures of Eukaryotic Phosphofructokinases from Baker's Yeast and Rabbit Skeletal Muscle.
13	AFDB:Q5AK53	0.908	0.723	2.802E-88	987	0.445	0.354	Q5AK53.pdb.gz	Q5AK53_CANAL ATP-dependent 6-phosphofructokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PFK1 PE=3 SV=1
14	PDB:4a3sA	0.372	0.898	1.097E-27	319	0.184	0.451	4a3sA.pdb.gz
15	PDB:1pfkA	0.368	0.882	5.511E-26	320	0.166	0.406	1pfkA.pdb.gz	Crystal structure of the complex of phosphofructokinase from Escherichia coli with its reaction products.
16	PDB:6qu3A	0.351	0.575	3.014E-19	464	0.114	0.192	6qu3A.pdb.gz	Fast acting allosteric phosphofructokinase inhibitors block trypanosome glycolysis and cure acute African trypanosomiasis in mice.
17	PDB:1kzhB	0.353	0.509	4.749E-15	530	0.094	0.140	1kzhB.pdb.gz	The structure of a pyrophosphate-dependent phosphofructokinase from the Lyme disease spirochete Borrelia burgdorferi.
18	PDB:2f48B	0.357	0.496	3.237E-13	552	0.099	0.141	2f48B.pdb.gz	Crystal Structure of A Novel Fructose 1,6-Bisphosphate and AlF3 containing Pyrophosphate-dependent Phosphofructo-1-kinase Complex from Borrelia burgdorferi
19	PDB:4xc6A	0.113	0.092	9.716E-4	1067	0.121	0.089	4xc6A.pdb.gz	Visualization of a radical B12 enzyme with its G-protein chaperone.
20	PDB:1i3kA	0.119	0.220	8.658E-3	347	0.046	0.104	1i3kA.pdb.gz	Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060WI24	1136	780	0.684	0.687	A0A060WI24_ONCMY ATP-dependent 6-phosphofructokinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00075887001 PE=3 SV=1
2	A0A060X7Z0	1128	811	0.695	0.672	A0A060X7Z0_ONCMY ATP-dependent 6-phosphofructokinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028237001 PE=3 SV=1
3	O14943	858	412	0.523	0.995	O14943_HUMAN Phosphofructokinase-P (Fragment) OS=Homo sapiens OX=9606 GN=PFK-P PE=2 SV=1
4	O42938	664	942	0.453	0.377	PFKA_SCHPO ATP-dependent 6-phosphofructokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pfk1 PE=1 SV=1
5	P00511	1138	780	0.698	0.701	PFKAM_RABIT ATP-dependent 6-phosphofructokinase, muscle type OS=Oryctolagus cuniculus OX=9986 GN=PFKM PE=1 SV=3
6	P08237	1149	780	0.704	0.708	PFKAM_HUMAN ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM PE=1 SV=2
7	P12382	1144	780	0.675	0.678	PFKAL_MOUSE ATP-dependent 6-phosphofructokinase, liver type OS=Mus musculus OX=10090 GN=Pfkl PE=1 SV=4
8	P16861	601	987	0.421	0.334	PFKA1_YEAST ATP-dependent 6-phosphofructokinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFK1 PE=1 SV=1
9	P16862	624	959	0.417	0.341	PFKA2_YEAST ATP-dependent 6-phosphofructokinase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFK2 PE=1 SV=4
10	P17858	1132	780	0.672	0.676	PFKAL_HUMAN ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6
11	P30835	1141	780	0.672	0.676	PFKAL_RAT ATP-dependent 6-phosphofructokinase, liver type OS=Rattus norvegicus OX=10116 GN=Pfkl PE=1 SV=3
12	P47857	1149	780	0.707	0.710	PFKAM_MOUSE ATP-dependent 6-phosphofructokinase, muscle type OS=Mus musculus OX=10090 GN=Pfkm PE=1 SV=3
13	P47858	1138	780	0.702	0.705	PFKAM_RAT ATP-dependent 6-phosphofructokinase, muscle type OS=Rattus norvegicus OX=10116 GN=Pfkm PE=1 SV=3
14	P47859	1479	791	0.916	0.908	PFKAP_RABIT ATP-dependent 6-phosphofructokinase, platelet type OS=Oryctolagus cuniculus OX=9986 GN=PFKP PE=1 SV=1
15	P47860	1421	788	0.878	0.873	PFKAP_RAT ATP-dependent 6-phosphofructokinase, platelet type OS=Rattus norvegicus OX=10116 GN=Pfkp PE=1 SV=2
16	P52034	931	788	0.587	0.584	PFKA_DROME ATP-dependent 6-phosphofructokinase OS=Drosophila melanogaster OX=7227 GN=Pfk PE=2 SV=2
17	P90521	643	834	0.407	0.382	PFKA_DICDI ATP-dependent 6-phosphofructokinase OS=Dictyostelium discoideum OX=44689 GN=pfkA PE=1 SV=2
18	Q01813	1625	784	1.000	1.000	PFKAP_HUMAN ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2
19	Q5AGZ8	618	946	0.421	0.349	Q5AGZ8_CANAL ATP-dependent 6-phosphofructokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PFK2 PE=3 SV=1
20	Q5AK53	657	987	0.444	0.353	Q5AK53_CANAL ATP-dependent 6-phosphofructokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PFK1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12210 Hrs_helical	9.3e+02	11.7	Hepatocyte growth factor-regulated tyrosine kinase substrate
2	PF00365 PFK	1.7e-198	669.2	Phosphofructokinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370517

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405573	0.992	Glucose-6-phosphate isomerase
2	9606.ENSP00000378669	0.978	Fructose-bisphosphate aldolase A
3	9606.ENSP00000345771	0.975	ATP-dependent 6-phosphofructokinase, muscle type
4	9606.ENSP00000226253	0.973	Belongs to the class I fructose-bisphosphate aldolase family
5	9606.ENSP00000363988	0.970	Belongs to the class I fructose-bisphosphate aldolase family
6	9606.ENSP00000269848	0.958	ATP-dependent 6-phosphofructokinase, liver type
7	9606.ENSP00000321259	0.958	Transaldolase
8	9606.ENSP00000364486	0.944	Fructose-1,6-bisphosphatase isozyme 2
9	9606.ENSP00000408025	0.944	Fructose-1,6-bisphosphatase 1
10	9606.ENSP00000391481	0.943	Transketolase
11	9606.ENSP00000451828	0.942	RAC-alpha serine/threonine-protein kinase
12	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
13	9606.ENSP00000402103	0.938	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
14	9606.ENSP00000280605	0.929	Transketolase-like protein 2
15	9606.ENSP00000358931	0.929	Transketolase-like protein 1
16	9606.ENSP00000318318	0.928	Mannose-6-phosphate isomerase
17	9606.ENSP00000320171	0.926	Pyruvate kinase PKM
18	9606.ENSP00000229270	0.924	Triosephosphate isomerase 1
19	9606.ENSP00000292432	0.913	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
20	9606.ENSP00000346643	0.913	Putative hexokinase HKDC1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003872	1.000	6-phosphofructokinase activity
GO:0005488	0.996	binding
GO:0005515	0.994	protein binding
GO:0097159	0.654	organic cyclic compound binding
GO:1901363	0.650	heterocyclic compound binding
GO:0042802	0.551	identical protein binding
GO:0043167	0.508	ion binding
GO:0036094	0.412	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0044238	0.998	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0006096	0.988	glycolytic process
GO:0050789	0.309	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.856	intracellular membrane-bounded organelle
GO:0032991	0.353	protein-containing complex
GO:0016020	0.307	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16109	1.000	ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 1,6-bisphosphate + H(+)
EC:2.7.1.11	1.000	6-phosphofructokinase.

[back to server]