StarFunc result for job id Q01826

User Input

>input (763 residues)
MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHS
GHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGY
SHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLP
PEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWY
KHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRTPL
PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKP
LEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ
SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIA
TERNGKPENNTMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSP
ENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQQQQQQQQ
QQQQQQQAPPPPQPQQQPQTGPRLPPRQPTVASPAESDEENRQKTRPRTKISVEALGILQ
SFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYLKHHGKLKDNSGLEVDVAEYK
EEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q60611	0.305	0.304	0.000	764	0.983	0.982	Q60611.pdb.gz	SATB1_MOUSE DNA-binding protein SATB1 OS=Mus musculus OX=10090 GN=Satb1 PE=1 SV=2
2	AFDB:A0A0G2KUW7	0.269	0.253	2.314E-74	818	0.733	0.683	A0A0G2KUW7.pdb.gz
3	AFDB:A0A024R3U6	0.319	0.330	5.485E-70	733	0.596	0.621	A0A024R3U6.pdb.gz
4	AFDB:A8WIP9	0.271	0.251	1.205E-62	834	0.565	0.517	A8WIP9.pdb.gz	A8WIP9_DANRE DNA-binding protein SATB OS=Danio rerio OX=7955 GN=si:ch211-223c6.1 PE=3 SV=1
5	AFDB:E1ANH4	0.281	0.255	2.907E-60	863	0.561	0.496	E1ANH4.pdb.gz
6	AFDB:Q9W268	0.132	0.101	2.233E-12	1024	0.145	0.108	Q9W268.pdb.gz	Q9W268_DROME Defective proventriculus, isoform A OS=Drosophila melanogaster OX=7227 GN=dve PE=2 SV=1
7	AFDB:O14529	0.117	0.070	3.408E-9	1486	0.180	0.092	O14529.pdb.gz	CUX2_HUMAN Homeobox protein cut-like 2 OS=Homo sapiens OX=9606 GN=CUX2 PE=1 SV=4
8	AFDB:P70298	0.127	0.078	9.241E-9	1426	0.186	0.100	P70298.pdb.gz	CUX2_MOUSE Homeobox protein cut-like 2 OS=Mus musculus OX=10090 GN=Cux2 PE=2 SV=2
9	AFDB:Q80Z36	0.097	0.085	5.248E-7	951	0.157	0.126	Q80Z36.pdb.gz	ZHX3_RAT Zinc fingers and homeoboxes protein 3 OS=Rattus norvegicus OX=10116 GN=Zhx3 PE=1 SV=2
10	AFDB:P39880	0.112	0.067	6.095E-7	1505	0.155	0.078	P39880.pdb.gz	CUX1_HUMAN Homeobox protein cut-like 1 OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=3
11	PDB:5npwC	0.074	0.169	2.321E-2	268	0.022	0.063	5npwC.pdb.gz
12	PDB:7lswC	0.084	0.320	3.290E-2	145	0.021	0.110	7lswC.pdb.gz
13	PDB:5azfA	0.085	0.395	3.821E-2	119	0.016	0.101	5azfA.pdb.gz	Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy.
14	PDB:7rbsB	0.065	0.211	5.418E-2	157	0.016	0.076	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
15	PDB:6mdhA	0.065	0.214	5.986E-2	149	0.013	0.067	6mdhA.pdb.gz
16	PDB:1j0gA	0.087	0.448	7.308E-2	92	0.014	0.120	1j0gA.pdb.gz
17	PDB:4rm8A	0.092	0.167	7.308E-2	368	0.031	0.065	4rm8A.pdb.gz
18	PDB:3plvA	0.077	0.383	9.377E-2	80	0.014	0.138	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
19	PDB:5ia8A	0.083	0.455	1.036E-1	92	0.014	0.120	5ia8A.pdb.gz
20	PDB:3wanB	0.087	0.367	1.089E-1	128	0.014	0.086	3wanB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8WIP9	0.0	750	834	0.567	0.519	A8WIP9_DANRE DNA-binding protein SATB OS=Danio rerio OX=7955 GN=si:ch211-223c6.1 PE=3 SV=1
2	C9JR56	0.0	733	674	0.522	0.591	C9JR56_HUMAN DNA-binding protein SATB OS=Homo sapiens OX=9606 GN=SATB2 PE=1 SV=1
3	Q01826	0.0	1577	763	1.000	1.000	SATB1_HUMAN DNA-binding protein SATB1 OS=Homo sapiens OX=9606 GN=SATB1 PE=1 SV=1
4	Q546B3	0.0	853	733	0.603	0.628	Q546B3_MOUSE DNA-binding protein SATB OS=Mus musculus OX=10090 GN=Satb2 PE=2 SV=1
5	Q60611	0.0	1550	764	0.984	0.983	SATB1_MOUSE DNA-binding protein SATB1 OS=Mus musculus OX=10090 GN=Satb1 PE=1 SV=2
6	Q8VI24	0.0	853	733	0.603	0.628	SATB2_MOUSE DNA-binding protein SATB2 OS=Mus musculus OX=10090 GN=Satb2 PE=1 SV=1
7	Q9UPW6	0.0	854	733	0.603	0.628	SATB2_HUMAN DNA-binding protein SATB2 OS=Homo sapiens OX=9606 GN=SATB2 PE=1 SV=2
8	D3ZJ19	2.23e-174	516	615	0.389	0.483	D3ZJ19_RAT DNA-binding protein SATB OS=Rattus norvegicus OX=10116 GN=Satb2 PE=3 SV=2
9	O76143	4.43e-09	62.4	1019	0.062	0.046	O76143_DROME Dve OS=Drosophila melanogaster OX=7227 GN=dve PE=2 SV=1
10	O77289	4.47e-09	62.4	1021	0.062	0.046	O77289_DROME Dve protein OS=Drosophila melanogaster OX=7227 GN=dve PE=2 SV=1
11	Q8MLT6	4.62e-09	62.4	780	0.063	0.062	Q8MLT6_DROME Defective proventriculus, isoform B OS=Drosophila melanogaster OX=7227 GN=dve PE=4 SV=2
12	Q8MQP8	4.75e-09	62.4	785	0.063	0.061	Q8MQP8_DROME RE03646p (Fragment) OS=Drosophila melanogaster OX=7227 GN=dve PE=2 SV=1
13	Q9W268	5.30e-09	62.4	1024	0.062	0.046	Q9W268_DROME Defective proventriculus, isoform A OS=Drosophila melanogaster OX=7227 GN=dve PE=2 SV=1
14	Q86MI0	7.75e-09	61.2	468	0.045	0.073	DVE1_CAEEL Homeobox protein dve-1 OS=Caenorhabditis elegans OX=6239 GN=dve-1 PE=1 SV=1
15	Q6PHC9	1.67e-04	47.4	461	0.038	0.063	Q6PHC9_DANRE One cut domain family member OS=Danio rerio OX=7955 GN=oc1 PE=2 SV=1
16	O95948	2.20e-04	47.0	504	0.039	0.060	ONEC2_HUMAN One cut domain family member 2 OS=Homo sapiens OX=9606 GN=ONECUT2 PE=2 SV=2
17	Q9UBC0	2.33e-04	47.0	465	0.035	0.058	HNF6_HUMAN Hepatocyte nuclear factor 6 OS=Homo sapiens OX=9606 GN=ONECUT1 PE=2 SV=1
18	Q6XBJ3	2.42e-04	47.0	505	0.039	0.059	ONEC2_MOUSE One cut domain family member 2 OS=Mus musculus OX=10090 GN=Onecut2 PE=2 SV=2
19	P70512	2.48e-04	46.6	465	0.035	0.058	HNF6_RAT Hepatocyte nuclear factor 6 OS=Rattus norvegicus OX=10116 GN=Onecut1 PE=1 SV=1
20	O08755	2.63e-04	46.6	465	0.035	0.058	HNF6_MOUSE Hepatocyte nuclear factor 6 OS=Mus musculus OX=10090 GN=Onecut1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02376 CUT	4.2e-32	121.4	CUT domain
2	PF16557 CUTL	4.8e-36	134.1	CUT1-like DNA-binding domain of SATB
3	PF00046 Homeodomain	0.0019	29.3	Homeodomain
4	PF01381 HTH_3	2e+02	13.4	Helix-turn-helix
5	PF16534 ULD	1.2e-33	126.9	Ubiquitin-like oligomerisation domain of SATB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000025318

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000060824	0.848	Protein inhibitor of activated STAT, 1
2	9598.ENSPTRP00000060659	0.832	Histone deacetylase
3	9598.ENSPTRP00000012969	0.816	Ubiquitin-conjugating enzyme E2I
4	9598.ENSPTRP00000028278	0.729	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
5	9598.ENSPTRP00000025331	0.727	Belongs to the acetyltransferase family. GCN5 subfamily.
6	9598.ENSPTRP00000044466	0.715	Catenin (Cadherin-associated protein), beta 1, 88kDa
7	9598.ENSPTRP00000021908	0.676	Small ubiquitin-like modifier 1
8	9598.ENSPTRP00000049696	0.660	Histone deacetylase
9	9598.ENSPTRP00000014062	0.649	CCCTC-binding factor (Zinc finger protein)
10	9598.ENSPTRP00000024078	0.630	Small ubiquitin-related modifier
11	9598.ENSPTRP00000060506	0.630	Small ubiquitin-related modifier
12	9598.ENSPTRP00000002056	0.609	Protein inhibitor of activated STAT, 3
13	9598.ENSPTRP00000017001	0.584	Protein inhibitor of activated STAT, 2
14	9598.ENSPTRP00000017578	0.575	Uncharacterized protein
15	9598.ENSPTRP00000017489	0.543	Protein inhibitor of activated STAT, 4
16	9598.ENSPTRP00000017778	0.523	Ubiquitin-like 5
17	9598.ENSPTRP00000058837	0.511	Ubiquitin-like 3
18	9598.ENSPTRP00000035178	0.505	Metastasis suppressor 1
19	9598.ENSPTRP00000061082	0.502	Small ubiquitin-like modifier 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003682	0.991	chromatin binding
GO:0008134	0.975	transcription factor binding
GO:0140297	0.963	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0009987	0.990	cellular process
GO:0006357	0.941	regulation of transcription by RNA polymerase II
GO:0048519	0.880	negative regulation of biological process
GO:0048523	0.865	negative regulation of cellular process
GO:0071840	0.809	cellular component organization or biogenesis
GO:0048518	0.765	positive regulation of biological process
GO:0016043	0.741	cellular component organization
GO:0045892	0.732	negative regulation of DNA-templated transcription
GO:0006325	0.703	chromatin organization
GO:0000122	0.662	negative regulation of transcription by RNA polymerase II
GO:0048522	0.608	positive regulation of cellular process
GO:0009893	0.598	positive regulation of metabolic process
GO:0010604	0.576	positive regulation of macromolecule metabolic process
GO:0051173	0.551	positive regulation of nitrogen compound metabolic process
GO:0031325	0.430	positive regulation of cellular metabolic process
GO:0032502	0.406	developmental process
GO:0031328	0.393	positive regulation of cellular biosynthetic process
GO:0045935	0.389	positive regulation of nucleobase-containing compound metabolic process
GO:1903508	0.367	positive regulation of nucleic acid-templated transcription
GO:0045893	0.352	positive regulation of DNA-templated transcription
GO:0008152	0.334	metabolic process
GO:0048856	0.324	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.592	intracellular non-membrane-bounded organelle
GO:0032991	0.526	protein-containing complex
GO:0016604	0.474	nuclear body
GO:0005737	0.421	cytoplasm
GO:0005694	0.318	chromosome
GO:0000785	0.306	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]