StarFunc result for job id Q01831

User Input

>input (940 residues)
MARKRAAGGEPRGRELRSQKSKAKSKARREEEEEDAFEDEKPPKKSLLSKVSQGKRKRGC
SHPGGSADGPAKKKVAKVTVKSENLKVIKDEALSDGDDLRDFPSDLKKAHHLKRGATMNE
DSNEEEEESENDWEEVEELSEPVLGDVRESTAFSRSLLPVKPVEIEIETPEQAKTRERSE
KIKLEFETYLRRAMKRFNKGVHEDTHKVHLLCLLANGFYRNNICSQPDLHAIGLSIIPAR
FTRVLPRDVDTYYLSNLVKWFIGTFTVNAELSASEQDNLQTTLERRFAIYSARDDEELVH
IFLLILRALQLLTRLVLSLQPIPLKSATAKGKKPSKERLTADPGGSSETSSQVLENHTKP
KTSKGTKQEETFAKGTCRPSAKGKRNKGGRKKRSKPSSSEEDEGPGDKQEKATQRRPHGR
ERRVASRVSYKEESGSDEAGSGSDFELSSGEASDPSDEDSEPGPPKQRKAPAPQRTKAGS
KSASRTHRGSHRKDPSLPAASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEE
KWVCVDCVHGVVGQPLTCYKYATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRKCRVDA
EWWAETLRPYQSPFMDREKKEDLEFQAKHMDQPLPTAIGLYKNHPLYALKRHLLKYEAIY
PETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLA
EPQLREENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIGCVQLNLPNLH
RVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWENEQAVIERKEKEKK
EKRALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARIL
AASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A3D8	0.605	0.609	0.000	933	0.741	0.747	D4A3D8.pdb.gz	D4A3D8_RAT XPC complex subunit, DNA damage recognition and repair factor OS=Rattus norvegicus OX=10116 GN=Xpc PE=1 SV=2
2	AFDB:Q01831	1.000	1.000	0.000	940	1.000	1.000	Q01831.pdb.gz	XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC PE=1 SV=4
3	PDB:7k04A	0.394	0.677	2.640E-26	524	0.118	0.212	7k04A.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
4	AFDB:P51521	0.058	0.045	1.332E-2	1351	0.128	0.089	P51521.pdb.gz	OVO_DROME Transcriptional regulator ovo OS=Drosophila melanogaster OX=7227 GN=ovo PE=1 SV=2
5	PDB:3eswA	0.090	0.242	1.497E-2	333	0.023	0.066	3eswA.pdb.gz	Structural and mutational studies on the importance of oligosaccharide binding for the activity of yeast PNGase.
6	AFDB:P51023	0.046	0.057	1.399E-1	718	0.078	0.102	P51023.pdb.gz	PNT_DROME ETS-like protein pointed OS=Drosophila melanogaster OX=7227 GN=pnt PE=1 SV=2
7	AFDB:B5ME60	0.037	0.052	1.655E-1	586	0.102	0.164	B5ME60.pdb.gz	B5ME60_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=4
8	AFDB:Q501D2	0.075	0.109	3.239E-1	572	0.071	0.117	Q501D2.pdb.gz	IQD30_ARATH Protein IQ-DOMAIN 30 OS=Arabidopsis thaliana OX=3702 GN=IQD30 PE=1 SV=1
9	AFDB:D3ZD05	0.061	0.066	4.793E-1	847	0.079	0.087	D3ZD05.pdb.gz	KANK2_RAT KN motif and ankyrin repeat domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Kank2 PE=1 SV=2
10	AFDB:Q3KP66	0.046	0.059	4.793E-1	663	0.074	0.106	Q3KP66.pdb.gz	INAVA_HUMAN Innate immunity activator protein OS=Homo sapiens OX=9606 GN=INAVA PE=1 SV=2
11	AFDB:Q7TN12	0.045	0.058	5.996E-1	663	0.077	0.109	Q7TN12.pdb.gz	INAVA_MOUSE Innate immunity activator protein OS=Mus musculus OX=10090 GN=Inava PE=2 SV=1
12	AFDB:Q8L8A8	0.041	0.058	6.341E-1	535	0.055	0.097	Q8L8A8.pdb.gz	GRF2_ARATH Growth-regulating factor 2 OS=Arabidopsis thaliana OX=3702 GN=GRF2 PE=1 SV=1
13	PDB:7tvzE	0.057	0.077	8.431E-1	665	0.012	0.017	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
14	PDB:2q3zA	0.074	0.101	8.916E-1	655	0.019	0.027	2q3zA.pdb.gz	Transglutaminase 2 undergoes a large conformational change upon activation
15	PDB:1w4tA	0.072	0.212	2.065	277	0.018	0.061	1w4tA.pdb.gz
16	PDB:7rroF1	0.043	0.074	2.889	421	0.020	0.045	7rroF1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	PDB:2b5uA	0.040	0.070	3.231	470	0.015	0.030	2b5uA.pdb.gz
18	PDB:6faiG	0.052	0.180	3.231	232	0.018	0.073	6faiG.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
19	PDB:6kzbC	0.068	0.092	3.231	649	0.020	0.029	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.
20	PDB:7rroA1	0.063	0.114	3.417	396	0.029	0.068	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A3D8	0.0	1306	980	0.753	0.722	D4A3D8_RAT XPC complex subunit, DNA damage recognition and repair factor OS=Rattus norvegicus OX=10116 GN=Xpc PE=1 SV=2
2	P51612	0.0	1261	930	0.736	0.744	XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus OX=10090 GN=Xpc PE=1 SV=2
3	Q01831	0.0	1935	940	1.000	1.000	XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC PE=1 SV=4
4	X5DRB1	0.0	1935	940	1.000	1.000	X5DRB1_HUMAN Xeroderma pigmentosum, complementation group C isoform A (Fragment) OS=Homo sapiens OX=9606 GN=XPC PE=2 SV=1
5	Q24595	5.87e-112	376	1293	0.190	0.138	XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster OX=7227 GN=Xpc PE=1 SV=2
6	E7EUB5	1.81e-104	323	168	0.178	0.994	E7EUB5_HUMAN XPC complex subunit, DNA damage recognition and repair factor (Fragment) OS=Homo sapiens OX=9606 GN=XPC PE=1 SV=1
7	Q9N4C3	3.44e-75	270	1119	0.159	0.133	Q9N4C3_CAEEL XPC (Xeroderma Pigmentosum group C) DNA repair gene homolog OS=Caenorhabditis elegans OX=6239 GN=xpc-1 PE=1 SV=2
8	Q8W489	8.42e-51	195	865	0.135	0.147	RAD4_ARATH DNA repair protein RAD4 OS=Arabidopsis thaliana OX=3702 GN=RAD4 PE=1 SV=1
9	P87235	1.74e-38	155	686	0.121	0.166	RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp42 PE=3 SV=1
10	Q38DK1	7.89e-35	145	768	0.121	0.148	Q38DK1_TRYB2 DNA-repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3040 PE=3 SV=1
11	Q10445	7.45e-33	138	638	0.119	0.176	RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp41 PE=3 SV=1
12	P14736	2.58e-25	115	754	0.109	0.135	RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD4 PE=1 SV=3
13	Q9FGY9	0.003	43.9	721	0.023	0.031	PNG1_ARATH Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Arabidopsis thaliana OX=3702 GN=PNG1 PE=2 SV=1
14	O74739	0.083	38.5	333	0.021	0.060	PNG1_SCHPO Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=png1 PE=2 SV=2
15	Q06665	0.53	36.6	692	0.051	0.069	RAD34_YEAST DNA repair protein RAD34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD34 PE=1 SV=1
16	Q9A5I5	1.2	35.0	454	0.041	0.086	PLED_CAUVC Response regulator PleD OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=pleD PE=1 SV=1
17	A7YT55	7.1	32.7	929	0.041	0.042	A7YT55_DANRE Hdac6 protein (Fragment) OS=Danio rerio OX=7955 GN=hdac6 PE=1 SV=1
18	F8W4B7	9.2	32.7	1081	0.041	0.036	F8W4B7_DANRE Histone deacetylase 6 OS=Danio rerio OX=7955 GN=hdac6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10403 BHD_1	9.7e-11	52.8	Rad4 beta-hairpin domain 1
2	PF10404 BHD_2	5.2e-11	54.6	Rad4 beta-hairpin domain 2
3	PF10405 BHD_3	4e-21	86.5	Rad4 beta-hairpin domain 3
4	PF03835 Rad4	8.4e-18	75.9	Rad4 transglutaminase-like domain
5	PF00643 zf-B_box	6.4e+02	11.9	B-box zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285021

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350708	0.999	UV excision repair protein RAD23 homolog B
2	9606.ENSP00000359300	0.999	Centrin-2
3	9606.ENSP00000265963	0.996	General transcription factor IIH subunit 1
4	9606.ENSP00000467024	0.996	UV excision repair protein RAD23 homolog A
5	9606.ENSP00000256996	0.989	DNA damage-binding protein 2
6	9606.ENSP00000013807	0.987	DNA excision repair protein ERCC-1
7	9606.ENSP00000310520	0.986	DNA repair endonuclease XPF
8	9606.ENSP00000352257	0.981	X-ray repair cross-complementing protein 6
9	9606.ENSP00000364270	0.976	DNA repair protein complementing XP-A cells
10	9606.ENSP00000263121	0.973	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
11	9606.ENSP00000347978	0.967	DNA repair protein complementing XP-G cells
12	9606.ENSP00000278616	0.959	Serine-protein kinase ATM
13	9606.ENSP00000234420	0.954	DNA mismatch repair protein Msh6
14	9606.ENSP00000285398	0.945	TFIIH basal transcription factor complex helicase XPB subunit
15	9606.ENSP00000233146	0.943	DNA mismatch repair protein Msh2
16	9606.ENSP00000453872	0.941	E3 ubiquitin-protein ligase Arkadia
17	9606.ENSP00000367527	0.937	Protein artemis
18	9606.ENSP00000301764	0.934	DNA damage-binding protein 1
19	9606.ENSP00000265038	0.933	DNA excision repair protein ERCC-8
20	9606.ENSP00000484288	0.930	DNA ligase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140299	1.000	small molecule sensor activity
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0003697	1.000	single-stranded DNA binding
GO:0003684	1.000	damaged DNA binding
GO:0000217	1.000	DNA secondary structure binding
GO:0030983	1.000	mismatched DNA binding
GO:0140612	0.982	DNA damage sensor activity
GO:0000405	0.982	bubble DNA binding
GO:0000404	0.982	heteroduplex DNA loop binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0050794	0.998	regulation of cellular process
GO:0044238	0.996	primary metabolic process
GO:0051716	0.996	cellular response to stimulus
GO:0044237	0.996	cellular metabolic process
GO:0051726	0.989	regulation of cell cycle
GO:0044260	0.988	cellular macromolecule metabolic process
GO:0090304	0.987	nucleic acid metabolic process
GO:0006974	0.985	cellular response to DNA damage stimulus
GO:0006259	0.980	DNA metabolic process
GO:0006281	0.973	DNA repair
GO:0009628	0.961	response to abiotic stimulus
GO:0009411	0.952	response to UV
GO:1901987	0.940	regulation of cell cycle phase transition
GO:0006289	0.931	nucleotide-excision repair
GO:0071214	0.926	cellular response to abiotic stimulus
GO:0019222	0.908	regulation of metabolic process
GO:0071478	0.907	cellular response to radiation
GO:0051171	0.899	regulation of nitrogen compound metabolic process
GO:0060255	0.898	regulation of macromolecule metabolic process
GO:0080090	0.880	regulation of primary metabolic process
GO:0031323	0.858	regulation of cellular metabolic process
GO:0071482	0.849	cellular response to light stimulus
GO:0048518	0.840	positive regulation of biological process
GO:0034644	0.839	cellular response to UV
GO:0019219	0.836	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.831	positive regulation of cellular process
GO:0051173	0.826	positive regulation of nitrogen compound metabolic process
GO:0010604	0.818	positive regulation of macromolecule metabolic process
GO:0031325	0.805	positive regulation of cellular metabolic process
GO:0007346	0.743	regulation of mitotic cell cycle
GO:0045935	0.706	positive regulation of nucleobase-containing compound metabolic process
GO:0009889	0.675	regulation of biosynthetic process
GO:0031326	0.673	regulation of cellular biosynthetic process
GO:0010468	0.670	regulation of gene expression
GO:0010556	0.665	regulation of macromolecule biosynthetic process
GO:0051252	0.615	regulation of RNA metabolic process
GO:2001141	0.613	regulation of RNA biosynthetic process
GO:0006355	0.533	regulation of DNA-templated transcription
GO:0031328	0.519	positive regulation of cellular biosynthetic process
GO:0010557	0.515	positive regulation of macromolecule biosynthetic process
GO:0045893	0.351	positive regulation of DNA-templated transcription
GO:0048523	0.327	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0031981	0.995	nuclear lumen
GO:0005654	0.991	nucleoplasm
GO:0016020	0.968	membrane
GO:0005829	0.960	cytosol
GO:0032991	0.933	protein-containing complex
GO:0005886	0.926	plasma membrane
GO:0005739	0.864	mitochondrion
GO:0005730	0.750	nucleolus
GO:0140513	0.564	nuclear protein-containing complex
GO:0071942	0.383	XPC complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]