StarFunc result for job id Q01844

User Input

>input (656 residues)
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTAT
YGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGT
QPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYP
MQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSY
PPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNR
GRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDN
SAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDP
PTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGP
GGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTEC
NQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFR
GGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K850	0.274	0.276	2.878E-93	651	0.979	0.986	A0A0G2K850.pdb.gz	A0A0G2K850_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=2
2	AFDB:A0A140UHY3	0.401	0.398	5.280E-93	661	0.983	0.976	A0A140UHY3.pdb.gz	A0A140UHY3_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
3	PDB:7dvqY	0.125	0.565	1.353E-8	140	0.041	0.193	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
4	PDB:7evoD	0.133	0.423	1.895E-8	200	0.035	0.115	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
5	PDB:6qx91K	0.120	0.380	7.297E-8	201	0.043	0.139	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
6	PDB:5yzg1	0.117	0.313	9.556E-8	243	0.040	0.107	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
7	PDB:5gm6V	0.129	0.615	1.339E-7	128	0.043	0.219	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
8	PDB:3lqvB	0.116	0.627	2.006E-7	115	0.034	0.191	3lqvB.pdb.gz	Branch Recognition by SF3b14
9	PDB:6y53o	0.116	0.463	3.215E-7	160	0.032	0.131	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
10	PDB:5xjcw	0.118	0.804	6.309E-7	91	0.043	0.308	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
11	PDB:6gd1A	0.117	0.391	1.324E-6	190	0.027	0.095	6gd1A.pdb.gz
12	PDB:6y5qq	0.125	0.430	1.984E-6	178	0.032	0.118	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	AFDB:P78332	0.117	0.075	4.089E-6	1123	0.127	0.074	P78332.pdb.gz	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
14	AFDB:Q9P789	0.110	0.068	4.374E-6	1065	0.146	0.090	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2
15	AFDB:Q8SY33	0.131	0.065	2.334E-4	1384	0.148	0.070	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
16	AFDB:A0A024R9Q9	0.115	0.096	8.987E-4	798	0.111	0.091	A0A024R9Q9.pdb.gz
17	AFDB:A0A0B4LEX9	0.067	0.046	1.441E-3	1376	0.201	0.096	A0A0B4LEX9.pdb.gz	A0A0B4LEX9_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Dmel\CG42326 PE=4 SV=1
18	AFDB:H7C269	0.118	0.087	1.441E-3	906	0.114	0.083	H7C269.pdb.gz	H7C269_HUMAN Trinucleotide repeat containing adaptor 6A (Fragment) OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=1
19	AFDB:Q96EV2	0.114	0.065	3.702E-3	1170	0.096	0.054	Q96EV2.pdb.gz	RBM33_HUMAN RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3
20	AFDB:D3ZHK8	0.093	0.086	8.892E-3	717	0.122	0.112	D3ZHK8.pdb.gz	D3ZHK8_RAT Cytoplasmic polyadenylation element binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cpeb2 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K850	0.0	1166	618	0.931	0.989	A0A0G2K850_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=2
2	A0A140UHY3	0.0	1241	661	0.985	0.977	A0A140UHY3_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
3	A0A8I6A3F5	0.0	587	354	0.491	0.910	A0A8I6A3F5_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=1
4	A0A8J8Y9N6	0.0	1214	654	0.970	0.972	A0A8J8Y9N6_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=1
5	B0QYK0	0.0	1174	618	0.942	1.000	B0QYK0_HUMAN EWS RNA binding protein 1 OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1
6	B1WC50	0.0	1247	655	0.985	0.986	B1WC50_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
7	Q01844	0.0	1263	656	1.000	1.000	EWS_HUMAN RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1
8	Q4KM41	0.0	621	317	0.476	0.984	Q4KM41_RAT Ewing sarcoma breakpoint region 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=2 SV=1
9	Q61545	0.0	1239	655	0.977	0.979	EWS_MOUSE RNA-binding protein EWS OS=Mus musculus OX=10090 GN=Ewsr1 PE=1 SV=2
10	Q803E3	1.53e-59	211	578	0.294	0.334	Q803E3_DANRE EWS RNA-binding protein 1b OS=Danio rerio OX=7955 GN=fb40b11 PE=1 SV=1
11	Q4QRG0	6.13e-49	182	579	0.293	0.332	Q4QRG0_DANRE EWS RNA-binding protein 1b OS=Danio rerio OX=7955 GN=fb40b11 PE=1 SV=1
12	Q3TLE4	8.23e-46	172	518	0.212	0.268	Q3TLE4_MOUSE TATA-binding protein-associated factor 2N OS=Mus musculus OX=10090 GN=Taf15 PE=2 SV=1
13	Q8BQ46	1.19e-45	172	557	0.212	0.250	Q8BQ46_MOUSE TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor OS=Mus musculus OX=10090 GN=Taf15 PE=1 SV=1
14	Q92804	5.48e-45	171	592	0.189	0.209	RBP56_HUMAN TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15 PE=1 SV=1
15	Q6J4Y8	2.05e-38	151	504	0.102	0.133	Q6J4Y8_CHICK FUS/TLS OS=Gallus gallus OX=9031 PE=1 SV=1
16	F6QCI0	1.47e-37	144	324	0.105	0.213	F6QCI0_MOUSE TATA-box binding protein associated factor 15 (Fragment) OS=Mus musculus OX=10090 GN=Taf15 PE=1 SV=1
17	Q27294	6.53e-21	97.8	399	0.064	0.105	CAZ_DROME RNA-binding protein cabeza OS=Drosophila melanogaster OX=7227 GN=caz PE=2 SV=2
18	Q9LF02	9.04e-14	76.6	519	0.059	0.075	Q9LF02_ARATH At5g16260 OS=Arabidopsis thaliana OX=3702 GN=ELF9 PE=1 SV=1
19	O43120	1.10e-10	66.2	367	0.059	0.106	UAP2_SCHPO Splicing factor U2AF-associated protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uap2 PE=1 SV=1
20	A0A8I6AN32	6.22e-10	62.8	280	0.035	0.082	A0A8I6AN32_RAT FUS RNA binding protein OS=Rattus norvegicus OX=10116 GN=Fus PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	2e-06	38.9	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF00641 zf-RanBP	2.5e-09	47.6	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000024474

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000022033	0.886	BRCA1 associated RING domain 1
2	9598.ENSPTRP00000002937	0.868	DEAH (Asp-Glu-Ala-His) box helicase 9
3	9598.ENSPTRP00000006506	0.818	Polymerase (RNA) II (DNA directed) polypeptide G
4	9598.ENSPTRP00000058203	0.814	Pan troglodytes TATA box binding protein (TBP), mRNA
5	9598.ENSPTRP00000006630	0.797	Splicing factor 1
6	9598.ENSPTRP00000059887	0.765	Y box binding protein 1
7	9598.ENSPTRP00000020368	0.763	Echinoderm microtubule associated protein like 4
8	9598.ENSPTRP00000000267	0.760	TAR DNA binding protein
9	9598.ENSPTRP00000000612	0.747	Uncharacterized protein
10	9598.ENSPTRP00000003457	0.723	Poly-ADP-ribosyltransferase that mediates poly-ADP- ribosylation of proteins and plays a key role in DNA repair.
11	9598.ENSPTRP00000010523	0.723	REC8 meiotic recombination protein
12	9598.ENSPTRP00000030865	0.711	U1 small nuclear ribonucleoprotein C
13	9598.ENSPTRP00000057448	0.701	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
14	9598.ENSPTRP00000014836	0.700	Cellular tumor antigen p53
15	9598.ENSPTRP00000015086	0.695	Uncharacterized protein
16	9598.ENSPTRP00000016892	0.676	Uncharacterized protein
17	9598.ENSPTRP00000033320	0.672	Zinc finger protein 3
18	9598.ENSPTRP00000047508	0.667	CD99 molecule
19	9598.ENSPTRP00000017736	0.666	Heterogeneous nuclear ribonucleoprotein M
20	9598.ENSPTRP00000058942	0.666	Ets variant 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.998	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050789	0.989	regulation of biological process
GO:0007275	0.986	multicellular organism development
GO:0050794	0.981	regulation of cellular process
GO:0007399	0.980	nervous system development
GO:0000278	0.977	mitotic cell cycle
GO:0030154	0.976	cell differentiation
GO:0071840	0.937	cellular component organization or biogenesis
GO:0021954	0.930	central nervous system neuron development
GO:0051726	0.901	regulation of cell cycle
GO:0016043	0.894	cellular component organization
GO:1903047	0.875	mitotic cell cycle process
GO:0033043	0.862	regulation of organelle organization
GO:0051783	0.840	regulation of nuclear division
GO:0006996	0.810	organelle organization
GO:0007346	0.805	regulation of mitotic cell cycle
GO:0051276	0.800	chromosome organization
GO:0050793	0.781	regulation of developmental process
GO:0048518	0.764	positive regulation of biological process
GO:0019222	0.762	regulation of metabolic process
GO:0022607	0.761	cellular component assembly
GO:0032330	0.756	regulation of chondrocyte differentiation
GO:0060255	0.728	regulation of macromolecule metabolic process
GO:0071704	0.708	organic substance metabolic process
GO:0000819	0.707	sister chromatid segregation
GO:0051171	0.705	regulation of nitrogen compound metabolic process
GO:0080090	0.704	regulation of primary metabolic process
GO:0044237	0.682	cellular metabolic process
GO:0044238	0.681	primary metabolic process
GO:0000022	0.675	mitotic spindle elongation
GO:0006807	0.658	nitrogen compound metabolic process
GO:0010564	0.635	regulation of cell cycle process
GO:0043170	0.630	macromolecule metabolic process
GO:0090307	0.630	mitotic spindle assembly
GO:0007088	0.611	regulation of mitotic nuclear division
GO:0034641	0.603	cellular nitrogen compound metabolic process
GO:0010468	0.596	regulation of gene expression
GO:0040008	0.587	regulation of growth
GO:0031323	0.570	regulation of cellular metabolic process
GO:1901360	0.555	organic cyclic compound metabolic process
GO:0090304	0.551	nucleic acid metabolic process
GO:0019219	0.525	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.489	positive regulation of cellular process
GO:0051252	0.483	regulation of RNA metabolic process
GO:0010556	0.453	regulation of macromolecule biosynthetic process
GO:0031326	0.453	regulation of cellular biosynthetic process
GO:0050896	0.431	response to stimulus
GO:0010467	0.391	gene expression
GO:0048519	0.356	negative regulation of biological process
GO:0009893	0.345	positive regulation of metabolic process
GO:0016070	0.343	RNA metabolic process
GO:0010604	0.311	positive regulation of macromolecule metabolic process
GO:0051173	0.300	positive regulation of nitrogen compound metabolic process
GO:1903506	0.300	regulation of nucleic acid-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	0.999	nucleolus
GO:0005737	0.986	cytoplasm
GO:0016604	0.873	nuclear body
GO:0032991	0.547	protein-containing complex
GO:0015030	0.313	Cajal body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]