StarFunc result for job id Q01851

User Input

>input (419 residues)
MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEA
LAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHI
SSPSLALMAGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGG
GLLGGSAHPHPHMHSLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQV
AAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPG
VGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRT
SIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17208	0.641	0.638	1.193E-48	421	0.995	0.990	P17208.pdb.gz	PO4F1_MOUSE POU domain, class 4, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou4f1 PE=1 SV=3
2	AFDB:F1Q813	0.387	0.440	2.011E-35	368	0.742	0.845	F1Q813.pdb.gz
3	AFDB:G3V7L5	0.338	0.344	6.137E-25	412	0.575	0.585	G3V7L5.pdb.gz	PO4F2_RAT POU domain, class 4, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou4f2 PE=1 SV=1
4	AFDB:P20267	0.204	0.192	5.299E-13	451	0.322	0.299	P20267.pdb.gz	PO3F1_RAT POU domain, class 3, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou3f1 PE=2 SV=2
5	AFDB:Q9VK71	0.195	0.107	4.974E-10	893	0.263	0.123	Q9VK71.pdb.gz	PDM2B_DROME POU domain protein 2, isoform B OS=Drosophila melanogaster OX=7227 GN=pdm2 PE=2 SV=2
6	PDB:6t90K	0.155	0.862	1.467E-4	73	0.093	0.534	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
7	AFDB:P18488	0.188	0.160	5.032E-3	497	0.184	0.155	P18488.pdb.gz	EMS_DROME Homeotic protein empty spiracles OS=Drosophila melanogaster OX=7227 GN=ems PE=2 SV=2
8	AFDB:Q9SJJ3	0.134	0.104	6.919E-3	584	0.150	0.108	Q9SJJ3.pdb.gz	BLH8_ARATH BEL1-like homeodomain protein 8 OS=Arabidopsis thaliana OX=3702 GN=BLH8 PE=1 SV=1
9	PDB:4egcA	0.152	0.127	1.564E-2	539	0.076	0.059	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
10	AFDB:Q04787	0.159	0.157	2.472E-2	429	0.169	0.166	Q04787.pdb.gz	BSH_DROME Brain-specific homeobox protein OS=Drosophila melanogaster OX=7227 GN=bsh PE=2 SV=5
11	AFDB:O18381	0.152	0.077	6.424E-2	857	0.138	0.068	O18381.pdb.gz	PAX6_DROME Paired box protein Pax-6 OS=Drosophila melanogaster OX=7227 GN=ey PE=1 SV=3
12	AFDB:G3UXB3	0.142	0.148	7.533E-2	402	0.131	0.137	G3UXB3.pdb.gz	NKX11_MOUSE NK1 transcription factor-related protein 1 OS=Mus musculus OX=10090 GN=Nkx1-1 PE=2 SV=2
13	PDB:3f51A	0.115	0.421	2.221E-1	94	0.036	0.160	3f51A.pdb.gz
14	PDB:6dv9F	0.085	0.162	2.746E-1	174	0.043	0.103	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
15	PDB:6jcxF	0.079	0.149	4.667E-1	186	0.081	0.183	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
16	PDB:2grmA	0.104	0.130	6.766E-1	315	0.055	0.073	2grmA.pdb.gz	Molecular basis for control of conjugation by bacterial pheromone and inhibitor peptides.
17	PDB:7f0rF	0.080	0.114	1.349	278	0.057	0.086	7f0rF.pdb.gz	Pseudomonas aeruginosa SutA wedges RNAP lobe domain open to facilitate promoter DNA unwinding.
18	PDB:7fbyA	0.094	0.231	1.500	153	0.021	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
19	PDB:2hi3A	0.126	0.648	1.668	73	0.026	0.151	2hi3A.pdb.gz
20	PDB:2w96A	0.099	0.143	1.668	249	0.038	0.064	2w96A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17208	0.0	823	421	0.993	0.988	PO4F1_MOUSE POU domain, class 4, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou4f1 PE=1 SV=3
2	P20266	0.0	586	420	0.947	0.945	PO4F1_RAT POU domain, class 4, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou4f1 PE=2 SV=3
3	Q01851	0.0	835	419	1.000	1.000	PO4F1_HUMAN POU domain, class 4, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU4F1 PE=1 SV=4
4	Q7SZN6	0.0	523	366	0.733	0.839	Q7SZN6_DANRE POU domain protein OS=Danio rerio OX=7955 GN=brn3a PE=2 SV=1
5	Q15319	1.41e-150	432	338	0.613	0.760	PO4F3_HUMAN POU domain, class 4, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU4F3 PE=1 SV=1
6	Q63955	1.43e-149	429	338	0.611	0.757	PO4F3_MOUSE POU domain, class 4, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou4f3 PE=1 SV=2
7	Q90435	3.02e-128	375	331	0.585	0.740	PO4F3_DANRE POU domain, class 4, transcription factor 3 OS=Danio rerio OX=7955 GN=pou4f3 PE=2 SV=2
8	Q6XZH1	1.24e-126	373	384	0.628	0.685	Q6XZH1_DANRE POU domain protein OS=Danio rerio OX=7955 GN=brn-3b PE=2 SV=1
9	P24350	8.56e-93	286	396	0.341	0.361	IPOU_DROME Inhibitory POU protein OS=Drosophila melanogaster OX=7227 GN=acj6 PE=1 SV=3
10	P13528	2.21e-78	248	357	0.284	0.333	UNC86_CAEEL Transcription factor unc-86 OS=Caenorhabditis elegans OX=6239 GN=unc-86 PE=1 SV=2
11	P16241	9.84e-47	167	427	0.191	0.187	CF1A_DROME POU domain protein CF1A OS=Drosophila melanogaster OX=7227 GN=vvl PE=2 SV=5
12	P56222	1.04e-44	162	445	0.191	0.180	PO3F2_RAT POU domain, class 3, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou3f2 PE=1 SV=1
13	Q2VUE0	1.36e-44	157	260	0.193	0.312	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
14	A0A2R8Y739	1.42e-44	160	361	0.246	0.285	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
15	P62515	2.13e-44	160	361	0.246	0.285	PO3F4_MOUSE POU domain, class 3, transcription factor 4 OS=Mus musculus OX=10090 GN=Pou3f4 PE=2 SV=1
16	P62516	2.13e-44	160	361	0.246	0.285	PO3F4_RAT POU domain, class 3, transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Pou3f4 PE=2 SV=1
17	P20265	2.23e-44	162	443	0.191	0.181	PO3F2_HUMAN POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4
18	P31360	2.31e-44	162	445	0.191	0.180	PO3F2_MOUSE POU domain, class 3, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou3f2 PE=1 SV=1
19	P49335	2.46e-44	159	361	0.246	0.285	PO3F4_HUMAN POU domain, class 3, transcription factor 4 OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=2
20	P31361	1.39e-43	160	497	0.191	0.161	PO3F3_MOUSE POU domain, class 3, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou3f3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	5.5e+02	11.9	Homeobox KN domain
2	PF00046 Homeodomain	8.3e-14	62.5	Homeodomain
3	PF13560 HTH_31	28	16.4	Helix-turn-helix domain
4	PF00157 Pou	1.6e-28	109.8	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366413

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405330	0.961	Estrogen receptor
2	9606.ENSP00000230658	0.865	Insulin gene enhancer protein ISL-1
3	9606.ENSP00000321805	0.799	GTP-binding protein Rit2
4	9606.ENSP00000363822	0.786	Androgen receptor
5	9606.ENSP00000302216	0.772	Protein atonal homolog 1
6	9606.ENSP00000261980	0.757	Visual system homeobox 2
7	9606.ENSP00000269305	0.745	Cellular tumor antigen p53
8	9606.ENSP00000361141	0.704	Melanopsin
9	9606.ENSP00000356357	0.700	LIM/homeobox protein Lhx9
10	9606.ENSP00000404100	0.699	Paired box protein Pax-6
11	9606.ENSP00000317580	0.684	Neurogenin-1
12	9606.ENSP00000362777	0.673	Protein atonal homolog 7
13	9606.ENSP00000340176	0.664	RNA-binding protein with multiple splicing
14	9606.ENSP00000400142	0.655	RNA-binding protein EWS
15	9606.ENSP00000226193	0.646	Recoverin
16	9606.ENSP00000317333	0.646	Neurogenin-2
17	9606.ENSP00000307508	0.643	Calretinin
18	9606.ENSP00000265431	0.639	Calbindin
19	9606.ENSP00000295108	0.624	Neurogenic differentiation factor 1
20	9606.ENSP00000296271	0.600	Rhodopsin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.993	transcription cis-regulatory region binding
GO:0000977	0.983	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.977	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.936	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0061629	0.923	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001217	0.815	DNA-binding transcription repressor activity
GO:0001227	0.811	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0019899	0.794	enzyme binding
GO:0003682	0.753	chromatin binding
GO:0051020	0.713	GTPase binding
GO:0003697	0.708	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0050794	0.992	regulation of cellular process
GO:0048856	0.991	anatomical structure development
GO:0009889	0.985	regulation of biosynthetic process
GO:0048518	0.978	positive regulation of biological process
GO:0009987	0.970	cellular process
GO:0007275	0.953	multicellular organism development
GO:0048731	0.944	system development
GO:0051252	0.922	regulation of RNA metabolic process
GO:0010468	0.907	regulation of gene expression
GO:0048522	0.903	positive regulation of cellular process
GO:0031326	0.885	regulation of cellular biosynthetic process
GO:2001141	0.878	regulation of RNA biosynthetic process
GO:1903506	0.874	regulation of nucleic acid-templated transcription
GO:0006355	0.814	regulation of DNA-templated transcription
GO:0048519	0.722	negative regulation of biological process
GO:0007399	0.719	nervous system development
GO:0048523	0.710	negative regulation of cellular process
GO:0048513	0.707	animal organ development
GO:0010604	0.673	positive regulation of macromolecule metabolic process
GO:1903508	0.656	positive regulation of nucleic acid-templated transcription
GO:0045893	0.646	positive regulation of DNA-templated transcription
GO:0006357	0.565	regulation of transcription by RNA polymerase II
GO:0050896	0.518	response to stimulus
GO:0045944	0.498	positive regulation of transcription by RNA polymerase II
GO:0051253	0.331	negative regulation of RNA metabolic process
GO:0010558	0.327	negative regulation of macromolecule biosynthetic process
GO:0031327	0.326	negative regulation of cellular biosynthetic process
GO:0030154	0.319	cell differentiation
GO:0045892	0.301	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.987	nucleoplasm
GO:0005737	0.830	cytoplasm
GO:0032991	0.603	protein-containing complex
GO:0005667	0.576	transcription regulator complex
GO:0043005	0.381	neuron projection
GO:0090575	0.370	RNA polymerase II transcription regulator complex
GO:0000785	0.369	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]