StarFunc result for job id Q01860

User Input

>input (360 residues)
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGI
PPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPG
AVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFS
QTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR
VRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA
AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D2IYK3	0.495	0.495	2.302E-46	360	1.000	1.000	D2IYK3.pdb.gz	D2IYK3_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU5F1 PE=2 SV=1
2	AFDB:P20263	0.656	0.669	6.468E-40	352	0.842	0.861	P20263.pdb.gz	PO5F1_MOUSE POU domain, class 5, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou5f1 PE=1 SV=1
3	AFDB:B7ZQA9	0.416	0.339	1.852E-19	445	0.422	0.342	B7ZQA9.pdb.gz	P5F12_XENLA POU domain, class 5, transcription factor 1.2 OS=Xenopus laevis OX=8355 GN=pou5f1.2 PE=1 SV=1
4	AFDB:Q9DAC9	0.218	0.235	4.265E-19	329	0.478	0.523	Q9DAC9.pdb.gz	PO5F2_MOUSE POU domain, class 5, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou5f2 PE=2 SV=1
5	AFDB:A7Y7W2	0.398	0.370	7.864E-19	389	0.403	0.373	A7Y7W2.pdb.gz	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
6	AFDB:P20267	0.374	0.303	1.465E-16	451	0.403	0.322	P20267.pdb.gz	PO3F1_RAT POU domain, class 3, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou3f1 PE=2 SV=2
7	AFDB:P20268	0.380	0.361	6.954E-16	380	0.322	0.305	P20268.pdb.gz	HM06_CAEEL Homeobox protein ceh-6 OS=Caenorhabditis elegans OX=6239 GN=ceh-6 PE=1 SV=3
8	AFDB:Q2VUE0	0.366	0.498	2.115E-15	260	0.328	0.454	Q2VUE0.pdb.gz	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
9	AFDB:A0A2R8Y739	0.385	0.384	3.899E-15	361	0.342	0.341	A0A2R8Y739.pdb.gz	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
10	AFDB:H0YNW1	0.382	0.327	5.948E-14	424	0.358	0.304	H0YNW1.pdb.gz	H0YNW1_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU2F2 PE=1 SV=1
11	PDB:6t90K	0.196	0.943	9.801E-9	73	0.197	0.973	6t90K.pdb.gz	Mechanisms of OCT4-SOX2 motif readout on nucleosomes.
12	PDB:4egcA	0.140	0.099	5.192E-3	539	0.092	0.061	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:4o8bA	0.122	0.369	5.866E-1	101	0.053	0.188	4o8bA.pdb.gz
14	PDB:2hi3A	0.139	0.606	7.746E-1	73	0.042	0.205	2hi3A.pdb.gz
15	PDB:7dcoL	0.107	0.090	1.278	435	0.061	0.051	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
16	PDB:5iplF	0.107	0.128	1.428	277	0.056	0.072	5iplF.pdb.gz	Structures of E. coli sigma S-transcription initiation complexes provide new insights into polymerase mechanism.
17	PDB:7fbyA	0.108	0.230	1.428	153	0.025	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
18	PDB:3dnvB	0.131	0.553	1.510	71	0.042	0.211	3dnvB.pdb.gz	Molecular mechanisms of HipA-mediated multidrug tolerance and its neutralization by HipB.
19	PDB:1b0nA	0.118	0.367	1.687	103	0.031	0.107	1b0nA.pdb.gz	An evolutionary link between sporulation and prophage induction in the structure of a repressor:anti-repressor complex.
20	PDB:2cyyA	0.114	0.253	1.886	151	0.022	0.053	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D2IYK3	0.0	728	360	1.000	1.000	D2IYK3_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU5F1 PE=2 SV=1
2	P20263	0.0	576	352	0.833	0.852	PO5F1_MOUSE POU domain, class 5, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou5f1 PE=1 SV=1
3	Q01860	0.0	728	360	1.000	1.000	PO5F1_HUMAN POU domain, class 5, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU5F1 PE=1 SV=1
4	Q06416	0.0	633	359	0.958	0.961	P5F1B_HUMAN Putative POU domain, class 5, transcription factor 1B OS=Homo sapiens OX=9606 GN=POU5F1B PE=5 SV=2
5	Q6MG27	0.0	576	352	0.839	0.858	Q6MG27_RAT POU domain protein OS=Rattus norvegicus OX=10116 GN=Pou5f1 PE=2 SV=1
6	E2JL35	8.13e-88	264	179	0.417	0.838	E2JL35_MOUSE Octamer-binding transcription factor 3 (Fragment) OS=Mus musculus OX=10090 GN=Pou5f1 PE=2 SV=1
7	Q9DAC9	5.13e-85	262	329	0.478	0.523	PO5F2_MOUSE POU domain, class 5, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou5f2 PE=2 SV=1
8	Q8N7G0	2.27e-77	243	328	0.431	0.473	PO5F2_HUMAN POU domain, class 5, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU5F2 PE=1 SV=1
9	A7Y7W2	6.70e-69	223	389	0.336	0.311	PO5F3_CHICK POU domain, class 5, transcription factor 3 OS=Gallus gallus OX=9031 GN=POU5F3 PE=1 SV=2
10	B7ZQA9	3.33e-68	223	445	0.306	0.247	P5F12_XENLA POU domain, class 5, transcription factor 1.2 OS=Xenopus laevis OX=8355 GN=pou5f1.2 PE=1 SV=1
11	Q7T103	7.79e-67	219	449	0.303	0.243	P5F11_XENLA POU domain, class 5, transcription factor 1.1 OS=Xenopus laevis OX=8355 GN=pou5f1.1 PE=1 SV=1
12	Q90270	8.23e-63	209	472	0.278	0.212	PO5F1_DANRE POU domain, class 5, transcription factor 1 OS=Danio rerio OX=7955 GN=pou5f1 PE=2 SV=1
13	Q2VUE0	1.98e-59	194	260	0.269	0.373	Q2VUE0_COTJA POU domain protein OS=Coturnix japonica OX=93934 GN=Brn-1 PE=2 SV=1
14	P62515	3.65e-59	197	361	0.275	0.274	PO3F4_MOUSE POU domain, class 3, transcription factor 4 OS=Mus musculus OX=10090 GN=Pou3f4 PE=2 SV=1
15	P62516	3.65e-59	197	361	0.275	0.274	PO3F4_RAT POU domain, class 3, transcription factor 4 OS=Rattus norvegicus OX=10116 GN=Pou3f4 PE=2 SV=1
16	A0A2R8Y739	4.11e-59	196	361	0.272	0.271	A0A2R8Y739_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU3F4 PE=1 SV=1
17	O73861	4.93e-59	197	372	0.272	0.263	O73861_CHICK POU domain protein OS=Gallus gallus OX=9031 GN=Oct-6 PE=3 SV=1
18	P20265	1.06e-58	198	443	0.272	0.221	PO3F2_HUMAN POU domain, class 3, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU3F2 PE=1 SV=4
19	P31360	1.11e-58	198	445	0.272	0.220	PO3F2_MOUSE POU domain, class 3, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou3f2 PE=1 SV=1
20	P79746	2.09e-58	195	378	0.269	0.257	PO3F2_DANRE POU domain, class 3, transcription factor 2 OS=Danio rerio OX=7955 GN=pou3f2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04412 AcnX	99	13.1	Aconitase X
2	PF05920 Homeobox_KN	5.5e+02	11.9	Homeobox KN domain
3	PF00046 Homeodomain	1.6e-15	68.0	Homeodomain
4	PF00157 Pou	9.6e-32	120.1	Pou domain - N-terminal to homeobox domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259915

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229307	0.999	Homeobox protein NANOG
2	9606.ENSP00000323588	0.999	Transcription factor SOX-2
3	9606.ENSP00000217086	0.998	Sal-like protein 4
4	9606.ENSP00000351446	0.998	WD repeat-containing protein 5
5	9606.ENSP00000344456	0.997	Catenin beta-1
6	9606.ENSP00000297316	0.996	Transcription factor SOX-17
7	9606.ENSP00000320171	0.996	Pyruvate kinase PKM
8	9606.ENSP00000422488	0.995	Steroid hormone receptor ERR2
9	9606.ENSP00000363314	0.994	Protein lin-28 homolog A
10	9606.ENSP00000363804	0.992	Krueppel-like factor 4
11	9606.ENSP00000360157	0.987	Forkhead box protein D3
12	9606.ENSP00000271640	0.986	Histone-lysine N-methyltransferase SETDB1
13	9606.ENSP00000335306	0.984	Developmental pluripotency-associated protein 4
14	9606.ENSP00000395654	0.983	Transcription activator BRG1
15	9606.ENSP00000264498	0.982	Fibroblast growth factor 2
16	9606.ENSP00000264010	0.981	Transcriptional repressor CTCF
17	9606.ENSP00000287538	0.981	Zinc finger protein ZIC 3
18	9606.ENSP00000251020	0.979	Sal-like protein 1
19	9606.ENSP00000296145	0.979	Teratocarcinoma-derived growth factor 1
20	9606.ENSP00000438483	0.977	Importin subunit alpha-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.996	sequence-specific double-stranded DNA binding
GO:0000981	0.995	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.971	transcription cis-regulatory region binding
GO:0008134	0.929	transcription factor binding
GO:0000977	0.894	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.881	cis-regulatory region sequence-specific DNA binding
GO:0001228	0.860	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0140297	0.750	DNA-binding transcription factor binding
GO:0019899	0.745	enzyme binding
GO:0000978	0.667	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0044389	0.629	ubiquitin-like protein ligase binding
GO:0061629	0.587	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0031625	0.568	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.996	regulation of gene expression
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0009889	0.975	regulation of biosynthetic process
GO:0048518	0.972	positive regulation of biological process
GO:0010556	0.945	regulation of macromolecule biosynthetic process
GO:0031326	0.945	regulation of cellular biosynthetic process
GO:0051252	0.945	regulation of RNA metabolic process
GO:0006355	0.942	regulation of DNA-templated transcription
GO:0032502	0.930	developmental process
GO:0048522	0.921	positive regulation of cellular process
GO:0048856	0.905	anatomical structure development
GO:0032501	0.864	multicellular organismal process
GO:0010604	0.851	positive regulation of macromolecule metabolic process
GO:0007275	0.839	multicellular organism development
GO:0051173	0.830	positive regulation of nitrogen compound metabolic process
GO:0031325	0.830	positive regulation of cellular metabolic process
GO:0050896	0.827	response to stimulus
GO:0048519	0.807	negative regulation of biological process
GO:0045893	0.718	positive regulation of DNA-templated transcription
GO:0048523	0.716	negative regulation of cellular process
GO:0048869	0.617	cellular developmental process
GO:0030154	0.610	cell differentiation
GO:0006357	0.577	regulation of transcription by RNA polymerase II
GO:0010605	0.524	negative regulation of macromolecule metabolic process
GO:0071704	0.510	organic substance metabolic process
GO:0051172	0.509	negative regulation of nitrogen compound metabolic process
GO:0031324	0.506	negative regulation of cellular metabolic process
GO:0044238	0.468	primary metabolic process
GO:0045944	0.443	positive regulation of transcription by RNA polymerase II
GO:0051716	0.442	cellular response to stimulus
GO:0051253	0.438	negative regulation of RNA metabolic process
GO:0009890	0.435	negative regulation of biosynthetic process
GO:0006807	0.434	nitrogen compound metabolic process
GO:0010558	0.433	negative regulation of macromolecule biosynthetic process
GO:0031327	0.433	negative regulation of cellular biosynthetic process
GO:0045892	0.419	negative regulation of DNA-templated transcription
GO:0048583	0.399	regulation of response to stimulus
GO:0043170	0.338	macromolecule metabolic process
GO:0000122	0.310	negative regulation of transcription by RNA polymerase II
GO:0044237	0.306	cellular metabolic process
GO:0050793	0.304	regulation of developmental process
GO:0009653	0.303	anatomical structure morphogenesis
GO:0010646	0.301	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.996	nucleoplasm
GO:0005829	0.983	cytosol
GO:0032991	0.604	protein-containing complex
GO:0005739	0.506	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]