StarFunc result for job id Q01954

User Input

>input (994 residues)
MRRRPPSRGGRGAARARETRRQPRHRSGRRMAEAISCTLNCSCQSFKPGKINHRQCDQCK
HGWVAHALSKLRIPPMYPTSQVEIVQSNVVFDISSLMLYGTQAIPVRLKILLDRLFSVLK
QDEVLQILHALDWTLQDYIRGYVLQDASGKVLDHWSIMTSEEEVATLQQFLRFGETKSIV
ELMAIQEKEEQSIIIPPSTANVDIRAFIESCSHRSSSLPTPVDKGNPSSIHPFENLISNM
TFMLPFQFFNPLPPALIGSLPEQYMLEQGHDQSQDPKQEVHGPFPDSSFLTSSSTPFQVE
KDQCLNCPDAITKKEDSTHLSDSSSYNIVTKFERTQLSPEAKVKPERNSLGTKKGRVFCT
ACEKTFYDKGTLKIHYNAVHLKIKHKCTIEGCNMVFSSLRSRNRHSANPNPRLHMPMNRN
NRDKDLRNSLNLASSENYKCPGFTVTSPDCRPPPSYPGSGEDSKGQPAFPNIGQNGVLFP
NLKTVQPVLPFYRSPATPAEVANTPGILPSLPLLSSSIPEQLISNEMPFDALPKKKSRKS
SMPIKIEKEAVEIANEKRHNLSSDEDMPLQVVSEDEQEACSPQSHRVSEEQHVQSGGLGK
PFPEGERPCHRESVIESSGAISQTPEQATHNSERETEQTPALIMVPREVEDGGHEHYFTP
GMEPQVPFSDYMELQQRLLAGGLFSALSNRGMAFPCLEDSKELEHVGQHALARQIEENRF
QCDICKKTFKNACSVKIHHKNMHVKEMHTCTVEGCNATFPSRRSRDRHSSNLNLHQKALS
QEALESSEDHFRAAYLLKDVAKEAYQDVAFTQQASQTSVIFKGTSRMGSLVYPITQVHSA
SLESYNSGPLSEGTILDLSTTSSMKSESSSHSSWDSDGVSEEGTVLMEDSDGNCEGSSLV
PGEDEYPICVLMEKADQSLASLPSGLPITCHLCQKTYSNKGTFRAHYKTVHLRQLHKCKV
PGCNTMFSSVRSRNRHSQNPNLHKSLASSPSHLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35914	0.370	0.380	0.000	961	0.846	0.875	O35914.pdb.gz	BNC1_MOUSE Zinc finger protein basonuclin-1 OS=Mus musculus OX=10090 GN=Bnc1 PE=1 SV=1
2	AFDB:Q01954	1.000	1.000	0.000	994	1.000	1.000	Q01954.pdb.gz	BNC1_HUMAN Zinc finger protein basonuclin-1 OS=Homo sapiens OX=9606 GN=BNC1 PE=1 SV=2
3	AFDB:A0A0R4IKC9	0.215	0.174	7.677E-64	1268	0.438	0.343	A0A0R4IKC9.pdb.gz	A0A0R4IKC9_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=1
4	AFDB:Q3TXU6	0.051	0.062	3.087E-6	800	0.116	0.144	Q3TXU6.pdb.gz	Q3TXU6_MOUSE Matrin-type domain-containing protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
5	AFDB:Q8VEH2	0.053	0.060	1.680E-5	845	0.124	0.146	Q8VEH2.pdb.gz	Q8VEH2_MOUSE CDKN1A interacting zinc finger protein 1 OS=Mus musculus OX=10090 GN=Ciz1 PE=1 SV=1
6	AFDB:B8A5T9	0.050	0.053	2.726E-5	927	0.138	0.148	B8A5T9.pdb.gz
7	AFDB:D9YZW0	0.049	0.054	2.717E-4	835	0.122	0.145	D9YZW0.pdb.gz	D9YZW0_HUMAN B-cell CLL/lymphoma 11A (Zinc finger protein), isoform CRA_b OS=Homo sapiens OX=9606 GN=BCL11A PE=4 SV=1
8	AFDB:A0A494C0L7	0.053	0.063	4.685E-4	820	0.122	0.148	A0A494C0L7.pdb.gz	A0A494C0L7_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
9	AFDB:Q9H582	0.066	0.052	1.310E-3	1327	0.137	0.102	Q9H582.pdb.gz	ZN644_HUMAN Zinc finger protein 644 OS=Homo sapiens OX=9606 GN=ZNF644 PE=1 SV=2
10	AFDB:O74808	0.049	0.042	2.550E-3	1238	0.145	0.116	O74808.pdb.gz	CLR1_SCHPO Cryptic loci regulator protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr1 PE=1 SV=1
11	PDB:3w5kB	0.030	0.212	3.440E-1	110	0.016	0.145	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:3j6bT	0.039	0.106	9.622E-1	209	0.021	0.100	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
13	PDB:6ydhA	0.023	0.219	1.383	62	0.010	0.161	6ydhA.pdb.gz
14	PDB:6yvuC	0.032	0.098	1.561	235	0.014	0.060	6yvuC.pdb.gz
15	PDB:6tdaS	0.043	0.051	2.534	783	0.024	0.031	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
16	PDB:6u68A	0.045	0.100	3.038	319	0.015	0.047	6u68A.pdb.gz
17	PDB:4rwtD	0.047	0.114	3.870	280	0.031	0.111	4rwtD.pdb.gz	Mechanisms of leiomodin 2-mediated regulation of actin filament in muscle cells.
18	PDB:7usdA	0.059	0.051	3.870	1185	0.021	0.018	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
19	PDB:3n71A	0.037	0.063	4.111	468	0.016	0.034	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
20	PDB:7dvqv	0.035	0.195	4.111	119	0.008	0.067	7dvqv.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5GY04	0.0	1997	987	0.967	0.974	F5GY04_HUMAN Basonuclin 1 OS=Homo sapiens OX=9606 GN=BNC1 PE=1 SV=1
2	O35914	0.0	1635	961	0.847	0.876	BNC1_MOUSE Zinc finger protein basonuclin-1 OS=Mus musculus OX=10090 GN=Bnc1 PE=1 SV=1
3	Q01954	0.0	2068	994	1.000	1.000	BNC1_HUMAN Zinc finger protein basonuclin-1 OS=Homo sapiens OX=9606 GN=BNC1 PE=1 SV=2
4	H0Y6W5	1.77e-174	532	860	0.300	0.347	H0Y6W5_HUMAN Basonuclin 2 (Fragment) OS=Homo sapiens OX=9606 GN=BNC2 PE=1 SV=1
5	B1APH0	1.41e-172	533	1032	0.300	0.289	B1APH0_HUMAN Basonuclin 2 OS=Homo sapiens OX=9606 GN=BNC2 PE=1 SV=1
6	Q6ZN30	1.40e-171	532	1099	0.300	0.271	BNC2_HUMAN Zinc finger protein basonuclin-2 OS=Homo sapiens OX=9606 GN=BNC2 PE=1 SV=1
7	Q8BMQ3	3.44e-171	532	1127	0.300	0.264	BNC2_MOUSE Zinc finger protein basonuclin-2 OS=Mus musculus OX=10090 GN=Bnc2 PE=1 SV=3
8	F1R425	8.70e-162	503	978	0.298	0.303	F1R425_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=2
9	C7DZJ6	5.13e-160	504	1171	0.298	0.253	C7DZJ6_DANRE Basonuclin-2 OS=Danio rerio OX=7955 GN=bnp PE=2 SV=1
10	A0A2R8QKL6	1.98e-159	504	1223	0.298	0.242	A0A2R8QKL6_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=1
11	A0A0R4IKC9	5.05e-159	504	1268	0.298	0.233	A0A0R4IKC9_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=1
12	F5H586	7.45e-139	435	729	0.252	0.343	F5H586_HUMAN Basonuclin 2 OS=Homo sapiens OX=9606 GN=BNC2 PE=1 SV=2
13	P23792	4.44e-17	88.2	568	0.049	0.086	DISC_DROME Protein disconnected OS=Drosophila melanogaster OX=7227 GN=disco PE=1 SV=2
14	Q9GSZ5	8.72e-17	87.8	729	0.039	0.053	Q9GSZ5_DROME Disco-related protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=disco-r PE=2 SV=1
15	Q9VXJ5	9.85e-17	88.2	1311	0.039	0.030	Q9VXJ5_DROME Disco-related, isoform A OS=Drosophila melanogaster OX=7227 GN=disco-r PE=4 SV=3
16	Q1ZXU0	1.76e-10	63.9	205	0.041	0.200	BNCH_CAEEL Basonuclin zinc finger protein homolog OS=Caenorhabditis elegans OX=6239 GN=bnc-1 PE=1 SV=1
17	Q96JB3	0.063	39.7	615	0.018	0.029	HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo sapiens OX=9606 GN=HIC2 PE=1 SV=2
18	A0A5K4F1D0	0.14	38.9	2566	0.030	0.012	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
19	Q7K0S9	0.15	38.1	384	0.016	0.042	GLIS2_DROME Zinc finger protein GLIS2 homolog OS=Drosophila melanogaster OX=7227 GN=sug PE=2 SV=1
20	P39943	0.16	38.1	394	0.020	0.051	MIG3_YEAST Transcription corepressor MIG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIG3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03614 Flag1_repress	1.7e+02	13.4	Repressor of phase-1 flagellin
2	PF00096 zf-C2H2	0.0031	29.0	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	0.005	28.5	C2H2-type zinc finger
4	PF17017 zf-C2H2_aberr	17	17.0	Aberrant zinc-finger
5	PF12171 zf-C2H2_jaz	0.93	21.1	Zinc-finger double-stranded RNA-binding
6	PF13465 zf-H2C2_2	6.8e+02	12.2	Zinc-finger double domain
7	PF12874 zf-met	0.00011	33.6	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307041

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376276	0.643	Serine/arginine-rich splicing factor 2
2	9606.ENSP00000306688	0.608	Olfactory receptor 2M4
3	9606.ENSP00000329357	0.582	Transcription factor Sp1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000182	1.000	rDNA binding
GO:0003700	0.997	DNA-binding transcription factor activity
GO:0005515	0.986	protein binding
GO:0001216	0.943	DNA-binding transcription activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0060255	0.984	regulation of macromolecule metabolic process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0080090	0.980	regulation of primary metabolic process
GO:0051171	0.980	regulation of nitrogen compound metabolic process
GO:0010468	0.972	regulation of gene expression
GO:0010556	0.972	regulation of macromolecule biosynthetic process
GO:0031326	0.972	regulation of cellular biosynthetic process
GO:0051252	0.972	regulation of RNA metabolic process
GO:0032502	0.900	developmental process
GO:0048522	0.878	positive regulation of cellular process
GO:0009987	0.877	cellular process
GO:0048856	0.841	anatomical structure development
GO:0006355	0.810	regulation of DNA-templated transcription
GO:0009893	0.728	positive regulation of metabolic process
GO:0010604	0.633	positive regulation of macromolecule metabolic process
GO:0042127	0.452	regulation of cell population proliferation
GO:0051173	0.323	positive regulation of nitrogen compound metabolic process
GO:0032501	0.321	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.743	cytoplasm
GO:0043232	0.326	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]