StarFunc result for job id Q01955

User Input

>input (1670 residues)
MSARTAPRPQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPGSP
GQKGFTGPEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLV
GVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPG
PQGLPGPPGFPGPVGPPGPPGFFGFPGAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGP
PGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGLQGKPG
KDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPG
PPGPRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSP
GCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCP
YIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKGEK
GETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGD
PGSPGSPGPAGPAGPPGYGPQGEPGLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGP
PGPPGHPGPQGPPGIPGSLGKCGDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSL
GCPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPG
TPGNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGD
PGIPGLDRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAI
GPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLK
GFAGNPGEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNM
GMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMG
KKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRGPPG
LPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKGDRGAPGFP
GLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPG
SHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGE
KGNPGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGP
PGNLGPCGPRGKPGKDGKPGTPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDSGSPAT
WTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTM
PFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAV
HSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRG
TCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01955	1.000	1.000	0.000	1670	1.000	1.000	Q01955.pdb.gz	CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens OX=9606 GN=COL4A3 PE=1 SV=3
2	AFDB:Q63ZW6	0.163	0.161	9.453E-72	1691	0.545	0.538	Q63ZW6.pdb.gz	Q63ZW6_MOUSE Col4a5 protein OS=Mus musculus OX=10090 GN=Col4a5 PE=1 SV=1
3	AFDB:F1MA59	0.164	0.164	3.107E-69	1669	0.534	0.534	F1MA59.pdb.gz	F1MA59_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
4	AFDB:P17140	0.152	0.144	5.172E-55	1758	0.490	0.466	P17140.pdb.gz	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
5	AFDB:P17139	0.145	0.138	8.112E-55	1759	0.485	0.460	P17139.pdb.gz	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
6	AFDB:Q14031	0.159	0.157	4.661E-53	1691	0.476	0.470	Q14031.pdb.gz	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
7	AFDB:P08572	0.147	0.144	4.424E-52	1712	0.474	0.463	P08572.pdb.gz	CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4
8	AFDB:B1AVK5	0.175	0.174	1.806E-51	1691	0.470	0.464	B1AVK5.pdb.gz	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
9	AFDB:F1M6Q3	0.148	0.150	2.997E-51	1645	0.462	0.469	F1M6Q3.pdb.gz	F1M6Q3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=4
10	AFDB:Q9QZR9	0.152	0.151	1.093E-50	1682	0.472	0.469	Q9QZR9.pdb.gz	CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus OX=10090 GN=Col4a4 PE=1 SV=1
11	PDB:6u3xB	0.042	0.110	4.422E-1	486	0.018	0.062	6u3xB.pdb.gz	From Screening to Targeted Degradation: Strategies for the Discovery and Optimization of Small Molecule Ligands for PCSK9.
12	PDB:5k1bA	0.028	0.100	4.678E-1	264	0.007	0.042	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
13	PDB:7ajuCL	0.029	0.043	5.236E-1	808	0.011	0.022	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:3jc54	0.025	0.046	8.687E-1	569	0.009	0.026	3jc54.pdb.gz
15	PDB:6zcaU	0.022	0.076	8.687E-1	231	0.008	0.056	6zcaU.pdb.gz	The delta subunit and NTPase HelD institute a two-pronged mechanism for RNA polymerase recycling.
16	PDB:3fxiC	0.026	0.118	1.151	140	0.012	0.143	3fxiC.pdb.gz
17	PDB:7wrgA	0.025	0.041	1.525	812	0.012	0.025	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
18	PDB:6hv92	0.016	0.039	1.706	549	0.006	0.018	6hv92.pdb.gz	Structure of DNA-CMG-Pol epsilon elucidates the roles of the non-catalytic polymerase modules in the eukaryotic replisome.
19	PDB:1xe8B	0.033	0.124	2.020	193	0.009	0.078	1xe8B.pdb.gz	Crystal structure of the YML079w protein from Saccharomyces cerevisiae reveals a new sequence family of the jelly-roll fold
20	PDB:7pmk5	0.018	0.039	2.392	673	0.007	0.018	7pmk5.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AFK7	0.0	596	1562	0.470	0.503	A0A8I6AFK7_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
2	B1AVK5	0.0	653	1691	0.460	0.455	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
3	F1LRJ1	0.0	1542	1671	0.771	0.770	F1LRJ1_RAT Collagen type IV alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col4a3 PE=4 SV=2
4	F1MA59	0.0	833	1669	0.526	0.526	F1MA59_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
5	O18407	0.0	675	1761	0.423	0.401	O18407_DROME Collagen type IV alpha 2 OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
6	P02462	0.0	748	1669	0.466	0.467	CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens OX=9606 GN=COL4A1 PE=1 SV=4
7	P02463	0.0	833	1669	0.525	0.525	CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus OX=10090 GN=Col4a1 PE=1 SV=4
8	P08120	0.0	759	1779	0.443	0.415	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3
9	P17139	0.0	828	1759	0.484	0.459	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
10	P17140	0.0	632	1758	0.407	0.386	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
11	Q01955	0.0	3013	1670	1.000	1.000	CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens OX=9606 GN=COL4A3 PE=1 SV=3
12	Q14031	0.0	686	1691	0.463	0.457	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
13	Q9ESQ1	0.0	650	1691	0.460	0.454	Q9ESQ1_MOUSE Type IV collagen alpha 6 chain OS=Mus musculus OX=10090 GN=Col4a6 PE=2 SV=1
14	Q9QZS0	0.0	1556	1669	0.789	0.789	CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus OX=10090 GN=Col4a3 PE=1 SV=2
15	Q9VMV5	0.0	674	1940	0.423	0.364	Q9VMV5_DROME Viking, isoform A OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
16	P08122	8.79e-172	566	1707	0.288	0.282	CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus OX=10090 GN=Col4a2 PE=1 SV=4
17	F1RLL9	1.18e-170	563	1712	0.400	0.390	F1RLL9_PIG Collagen type IV alpha 2 chain OS=Sus scrofa OX=9823 GN=COL4A2 PE=1 SV=3
18	A0A8I6AVZ9	7.22e-170	559	1619	0.403	0.416	A0A8I6AVZ9_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=1
19	A0A8I6AHV3	1.33e-166	551	1678	0.285	0.284	A0A8I6AHV3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=1
20	F1M6Q3	1.48e-166	551	1707	0.285	0.279	F1M6Q3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01413 C4	4.1e-78	270.3	C-terminal tandem repeated domain in type 4 procollagen
2	PF01391 Collagen	9.8e-189	622.7	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379823

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379866	0.949	Collagen alpha-4(IV) chain
2	9606.ENSP00000452786	0.941	Integrin beta-3
3	9606.ENSP00000261023	0.933	Integrin alpha-V
4	9606.ENSP00000282588	0.926	Integrin alpha-1
5	9606.ENSP00000296585	0.926	Integrin alpha-2
6	9606.ENSP00000364140	0.925	Collagen alpha-1(XV) chain
7	9606.ENSP00000379350	0.925	Integrin beta-1
8	9606.ENSP00000341189	0.921	Focal adhesion kinase 1
9	9606.ENSP00000353654	0.918	Collagen alpha-2(IV) chain
10	9606.ENSP00000378340	0.915	Collagen alpha-6(IV) chain
11	9606.ENSP00000331902	0.911	Collagen alpha-5(IV) chain
12	9606.ENSP00000364979	0.911	Collagen alpha-1(IV) chain
13	9606.ENSP00000363973	0.907	Alkaline phosphatase, tissue-nonspecific isozyme
14	9606.ENSP00000263556	0.905	Prolyl 4-hydroxylase subunit alpha-1
15	9606.ENSP00000355361	0.905	Leukocyte surface antigen CD47
16	9606.ENSP00000226284	0.904	Bone sialoprotein 2
17	9606.ENSP00000370542	0.904	Syndecan-1
18	9606.ENSP00000253496	0.903	Coagulation factor XII
19	9606.ENSP00000351273	0.902	Caspase-8
20	9606.ENSP00000384999	0.902	Prolyl 4-hydroxylase subunit alpha-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030020	0.998	extracellular matrix structural constituent conferring tensile strength
GO:0044877	0.960	protein-containing complex binding
GO:0050839	0.960	cell adhesion molecule binding
GO:0005102	0.950	signaling receptor binding
GO:0005178	0.899	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.995	anatomical structure development
GO:0009987	0.993	cellular process
GO:0007275	0.985	multicellular organism development
GO:0050789	0.978	regulation of biological process
GO:0050794	0.970	regulation of cellular process
GO:0050896	0.955	response to stimulus
GO:0030198	0.911	extracellular matrix organization
GO:1901342	0.886	regulation of vasculature development
GO:0048519	0.801	negative regulation of biological process
GO:0051716	0.784	cellular response to stimulus
GO:0048731	0.771	system development
GO:0051093	0.751	negative regulation of developmental process
GO:0007154	0.744	cell communication
GO:0051241	0.743	negative regulation of multicellular organismal process
GO:0072006	0.737	nephron development
GO:0007165	0.732	signal transduction
GO:0042221	0.727	response to chemical
GO:0007166	0.722	cell surface receptor signaling pathway
GO:0022603	0.711	regulation of anatomical structure morphogenesis
GO:0048518	0.707	positive regulation of biological process
GO:0007167	0.681	enzyme-linked receptor protein signaling pathway
GO:0045765	0.672	regulation of angiogenesis
GO:0010033	0.670	response to organic substance
GO:0060255	0.641	regulation of macromolecule metabolic process
GO:0051171	0.627	regulation of nitrogen compound metabolic process
GO:0048523	0.625	negative regulation of cellular process
GO:0080090	0.619	regulation of primary metabolic process
GO:1901343	0.572	negative regulation of vasculature development
GO:1901700	0.570	response to oxygen-containing compound
GO:0016525	0.500	negative regulation of angiogenesis
GO:0007169	0.394	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0009888	0.379	tissue development
GO:0048869	0.362	cellular developmental process
GO:0051246	0.344	regulation of protein metabolic process
GO:0030154	0.340	cell differentiation
GO:0042127	0.335	regulation of cell population proliferation
GO:0048522	0.317	positive regulation of cellular process
GO:0009653	0.314	anatomical structure morphogenesis
GO:0051173	0.309	positive regulation of nitrogen compound metabolic process
GO:0032835	0.309	glomerulus development
GO:0010604	0.306	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0012505	0.997	endomembrane system
GO:0005737	0.997	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0070013	0.996	intracellular organelle lumen
GO:0005576	0.990	extracellular region
GO:0099080	0.975	supramolecular complex
GO:0005581	0.973	collagen trimer
GO:0099081	0.970	supramolecular polymer
GO:0005604	0.969	basement membrane
GO:0098644	0.968	complex of collagen trimers
GO:0005587	0.960	collagen type IV trimer
GO:0005788	0.948	endoplasmic reticulum lumen
GO:0005615	0.844	extracellular space
GO:0016020	0.792	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]