StarFunc result for job id Q01970

User Input

>input (1234 residues)
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDS
AGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGD
EGLNRGPYVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQL
GSQPSSNPTPSPLDASPRRPPGPTTSPASTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLRSRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVED
TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQF
KRLKEMNEREKKELQKILDRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
DGPLVACASNGHAPGSSGHLSGADSESQEENTQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4gnkB	0.620	0.994	0.000	769	0.622	0.999	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
2	AFDB:A0A0R4IVA6	0.745	0.739	0.000	1245	0.575	0.570	A0A0R4IVA6.pdb.gz	A0A0R4IVA6_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Danio rerio OX=7955 GN=Plcbeta3 PE=1 SV=2
3	AFDB:O89040	0.636	0.663	0.000	1183	0.438	0.456	O89040.pdb.gz	PLCB2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Rattus norvegicus OX=10116 GN=Plcb2 PE=2 SV=1
4	AFDB:P10687	0.642	0.651	0.000	1216	0.544	0.552	P10687.pdb.gz	PLCB1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Rattus norvegicus OX=10116 GN=Plcb1 PE=1 SV=1
5	AFDB:P25455	0.654	0.614	0.000	1318	0.412	0.386	P25455.pdb.gz	PIP1_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II OS=Drosophila melanogaster OX=7227 GN=Plc21C PE=2 SV=3
6	AFDB:P51432	0.892	0.892	0.000	1234	0.923	0.923	P51432.pdb.gz	PLCB3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Mus musculus OX=10090 GN=Plcb3 PE=1 SV=2
7	AFDB:Q00722	0.635	0.661	0.000	1185	0.442	0.461	Q00722.pdb.gz	PLCB2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Homo sapiens OX=9606 GN=PLCB2 PE=1 SV=2
8	AFDB:Q91086	0.630	0.642	0.000	1211	0.448	0.457	Q91086.pdb.gz	Q91086_MELGA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Meleagris gallopavo OX=9103 PE=1 SV=1
9	AFDB:Q15147	0.598	0.627	1.921E-95	1175	0.355	0.373	Q15147.pdb.gz	PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens OX=9606 GN=PLCB4 PE=1 SV=3
10	AFDB:P13217	0.600	0.675	3.287E-95	1095	0.323	0.364	P13217.pdb.gz	PIPA_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=norpA PE=1 SV=4
11	AFDB:G5EBH0	0.599	0.518	3.856E-90	1431	0.355	0.306	G5EBH0.pdb.gz	PLCB_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 OS=Caenorhabditis elegans OX=6239 GN=egl-8 PE=1 SV=1
12	PDB:1cjyA	0.086	0.163	9.161E-5	633	0.020	0.039	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:7lq1A	0.084	0.106	5.860E-4	950	0.019	0.025	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
14	PDB:6pyuA	0.084	0.110	9.095E-4	930	0.019	0.025	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
15	PDB:5ixcA	0.078	0.138	1.280E-3	684	0.018	0.032	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:6gy0A	0.086	0.125	1.280E-3	822	0.020	0.030	6gy0A.pdb.gz	A class of highly selective inhibitors bind to an active state of PI3K gamma.
17	PDB:4ajwB	0.080	0.121	1.716E-3	792	0.025	0.039	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
18	PDB:5izrC	0.082	0.149	2.191E-3	659	0.019	0.035	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
19	PDB:5iz5B	0.086	0.138	3.238E-3	746	0.017	0.028	5iz5B.pdb.gz
20	PDB:6kxkD	0.083	0.172	6.737E-3	553	0.022	0.049	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IVA6	1397	1245	0.585	0.580	A0A0R4IVA6_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Danio rerio OX=7955 GN=Plcbeta3 PE=1 SV=2
2	A2AT91	714	883	0.319	0.446	A2AT91_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
3	A2TJ25	1401	1244	0.586	0.581	A2TJ25_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Danio rerio OX=7955 GN=Plcbeta3 PE=1 SV=1
4	A3KGF7	1012	1181	0.442	0.462	PLCB2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Mus musculus OX=10090 GN=Plcb2 PE=1 SV=1
5	G1MWY7	976	907	0.387	0.527	G1MWY7_MELGA Phosphoinositide phospholipase C OS=Meleagris gallopavo OX=9103 PE=4 SV=2
6	O89040	1009	1183	0.438	0.456	PLCB2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Rattus norvegicus OX=10116 GN=Plcb2 PE=2 SV=1
7	P10687	1276	1216	0.545	0.553	PLCB1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Rattus norvegicus OX=10116 GN=Plcb1 PE=1 SV=1
8	P10894	1273	1216	0.548	0.556	PLCB1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Bos taurus OX=9913 GN=PLCB1 PE=1 SV=1
9	P25455	866	1318	0.419	0.392	PIP1_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II OS=Drosophila melanogaster OX=7227 GN=Plc21C PE=2 SV=3
10	P51432	2239	1234	0.923	0.923	PLCB3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Mus musculus OX=10090 GN=Plcb3 PE=1 SV=2
11	Q00722	1010	1185	0.455	0.474	PLCB2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Homo sapiens OX=9606 GN=PLCB2 PE=1 SV=2
12	Q01970	2538	1234	1.000	1.000	PLCB3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3 PE=1 SV=2
13	Q15147	763	1175	0.374	0.392	PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens OX=9606 GN=PLCB4 PE=1 SV=3
14	Q5FWA6	709	892	0.318	0.439	Q5FWA6_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=2 SV=1
15	Q91086	985	1211	0.388	0.396	Q91086_MELGA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Meleagris gallopavo OX=9103 PE=1 SV=1
16	Q91UZ1	759	1175	0.374	0.393	Q91UZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
17	Q99JE6	2191	1234	0.914	0.914	PLCB3_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Rattus norvegicus OX=10116 GN=Plcb3 PE=1 SV=2
18	Q9NQ66	1276	1216	0.549	0.557	PLCB1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Homo sapiens OX=9606 GN=PLCB1 PE=1 SV=1
19	Q9QW07	754	1175	0.374	0.392	PLCB4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Rattus norvegicus OX=10116 GN=Plcb4 PE=1 SV=2
20	Q9Z1B3	1277	1216	0.545	0.553	PLCB1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Mus musculus OX=10090 GN=Plcb1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	0.0022	29.6	C2 domain
2	PF06631 DUF1154	0.81	20.9	Protein of unknown function (DUF1154)
3	PF09279 EF-hand_like	6.7e-07	41.1	Phosphoinositide-specific phospholipase C, efhand-like
4	PF17787 PH_14	8.1e-39	143.9	PH domain
5	PF00388 PI-PLC-X	2.9e-53	190.8	Phosphatidylinositol-specific phospholipase C, X domain
6	PF00387 PI-PLC-Y	2.9e-37	138.9	Phosphatidylinositol-specific phospholipase C, Y domain
7	PF08703 PLC-beta_C	9.6e-47	170.6	PLC-beta C terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000443631

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286548	0.998	Guanine nucleotide-binding protein G(q) subunit alpha
2	9606.ENSP00000408005	0.968	Na(+)/H(+) exchange regulatory cofactor NHE-RF2
3	9606.ENSP00000078429	0.955	Guanine nucleotide-binding protein subunit alpha-11
4	9606.ENSP00000368683	0.953	Endothelin-1
5	9606.ENSP00000443256	0.948	Lysophosphatidic acid receptor 2
6	9606.ENSP00000365807	0.935	Guanine nucleotide-binding protein subunit alpha-14
7	9606.ENSP00000334448	0.934	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
8	9606.ENSP00000373399	0.933	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
9	9606.ENSP00000315011	0.932	Endothelin-1 receptor
10	9606.ENSP00000357883	0.929	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
11	9606.ENSP00000262958	0.924	Guanine nucleotide-binding protein subunit alpha-15
12	9606.ENSP00000265382	0.920	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
13	9606.ENSP00000481878	0.920	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
14	9606.ENSP00000466363	0.919	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
15	9606.ENSP00000365757	0.918	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
16	9606.ENSP00000347032	0.913	Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
17	9606.ENSP00000229795	0.912	Mitogen-activated protein kinase 14
18	9606.ENSP00000366416	0.912	Endothelin receptor type B
19	9606.ENSP00000482548	0.912	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta
20	9606.ENSP00000260402	0.905	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004435	1.000	phosphatidylinositol phospholipase C activity
GO:0098772	0.783	molecular function regulator activity
GO:0140677	0.504	molecular function activator activity
GO:0043167	0.487	ion binding
GO:0005516	0.466	calmodulin binding
GO:0008289	0.317	lipid binding
GO:0005543	0.303	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0023052	0.997	signaling
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0007154	0.997	cell communication
GO:0050896	0.995	response to stimulus
GO:0007165	0.986	signal transduction
GO:0006650	0.985	glycerophospholipid metabolic process
GO:0007186	0.984	G protein-coupled receptor signaling pathway
GO:0046488	0.984	phosphatidylinositol metabolic process
GO:0032501	0.774	multicellular organismal process
GO:0003008	0.337	system process
GO:0048518	0.300	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.974	protein-containing complex
GO:0016020	0.974	membrane
GO:0005886	0.949	plasma membrane
GO:0043231	0.770	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:33179	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	1.000	phosphoinositide phospholipase C.

[back to server]