StarFunc result for job id Q01973

User Input

>input (937 residues)
MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTL
DEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRN
LDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACAR
FIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSS
VPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIG
IPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHS
YCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIAL
LFFFICVCRNNQKSSSAPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELG
ECAFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLG
AVTQEQPVCMLFEYINQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIA
AGMEYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMP
PEAIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPR
MYSLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSN
LSNPRYPNYMFPSQGITPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPTG
PPRVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGMGIT
VFGNKSQKPYKIDSKQASLLGDANIHGHTESMISAEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FCE4	0.356	0.355	0.000	939	0.546	0.545	E7FCE4.pdb.gz	E7FCE4_DANRE Receptor tyrosine kinase-like orphan receptor 2 OS=Danio rerio OX=7955 GN=ror2 PE=1 SV=1
2	AFDB:Q8AV69	0.363	0.366	0.000	930	0.565	0.569	Q8AV69.pdb.gz	Q8AV69_XENLA Receptor tyrosine kinase Xror2 OS=Xenopus laevis OX=8355 GN=ror2.L PE=2 SV=1
3	AFDB:Q9Z138	0.526	0.523	0.000	944	0.569	0.565	Q9Z138.pdb.gz	ROR2_MOUSE Tyrosine-protein kinase transmembrane receptor ROR2 OS=Mus musculus OX=10090 GN=Ror2 PE=1 SV=2
4	AFDB:Q24488	0.289	0.394	2.504E-57	685	0.275	0.377	Q24488.pdb.gz	ROR1_DROME Tyrosine-protein kinase transmembrane receptor Ror OS=Drosophila melanogaster OX=7227 GN=Ror PE=1 SV=1
5	AFDB:A0A0R4ITX7	0.296	0.345	7.197E-37	801	0.194	0.227	A0A0R4ITX7.pdb.gz
6	AFDB:P35968	0.298	0.209	1.622E-32	1356	0.175	0.121	P35968.pdb.gz	VGFR2_HUMAN Vascular endothelial growth factor receptor 2 OS=Homo sapiens OX=9606 GN=KDR PE=1 SV=2
7	AFDB:P55144	0.276	0.293	3.953E-32	880	0.176	0.188	P55144.pdb.gz	TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus OX=10090 GN=Tyro3 PE=1 SV=2
8	AFDB:Q06418	0.286	0.300	5.222E-32	890	0.194	0.204	Q06418.pdb.gz	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
9	AFDB:P30530	0.287	0.300	4.333E-31	894	0.185	0.194	P30530.pdb.gz	UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens OX=9606 GN=AXL PE=1 SV=4
10	AFDB:P35917	0.254	0.177	8.937E-31	1363	0.178	0.123	P35917.pdb.gz	VGFR3_MOUSE Vascular endothelial growth factor receptor 3 OS=Mus musculus OX=10090 GN=Flt4 PE=1 SV=1
11	PDB:2h8hA	0.253	0.515	1.361E-23	445	0.110	0.231	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:4fl2A	0.261	0.433	1.521E-23	555	0.107	0.180	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.261	0.437	2.043E-21	551	0.098	0.167	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.254	0.528	1.792E-20	441	0.098	0.209	1k9aB.pdb.gz
15	PDB:7mfdA	0.252	0.547	3.058E-16	410	0.092	0.210	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
16	PDB:8dksA	0.220	0.666	1.375E-15	283	0.085	0.283	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
17	PDB:6s73A	0.248	0.803	4.427E-15	269	0.062	0.216	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:4rerA	0.237	0.467	5.532E-15	459	0.067	0.137	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:5ufuA	0.241	0.581	5.532E-15	369	0.066	0.168	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:4zhxA	0.238	0.521	8.169E-15	409	0.063	0.144	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZQX3	0.0	1699	873	0.895	0.961	A0A8I5ZQX3_RAT Receptor tyrosine kinase-like orphan receptor 1 OS=Rattus norvegicus OX=10116 GN=Ror1 PE=1 SV=1
2	A0A8I5ZRJ7	0.0	1025	931	0.551	0.554	A0A8I5ZRJ7_RAT Receptor tyrosine kinase-like orphan receptor 2 OS=Rattus norvegicus OX=10116 GN=Ror2 PE=3 SV=1
3	A1L4F5	0.0	1035	943	0.553	0.549	A1L4F5_HUMAN Receptor tyrosine kinase-like orphan receptor 2 OS=Homo sapiens OX=9606 GN=ROR2 PE=1 SV=1
4	D3ZNY8	0.0	1025	943	0.551	0.547	D3ZNY8_RAT Receptor tyrosine kinase-like orphan receptor 2 OS=Rattus norvegicus OX=10116 GN=Ror2 PE=3 SV=1
5	D3ZZ97	0.0	1897	937	0.967	0.967	D3ZZ97_RAT Receptor tyrosine kinase-like orphan receptor 1 OS=Rattus norvegicus OX=10116 GN=Ror1 PE=3 SV=3
6	E7FCE4	0.0	970	939	0.539	0.538	E7FCE4_DANRE Receptor tyrosine kinase-like orphan receptor 2 OS=Danio rerio OX=7955 GN=ror2 PE=1 SV=1
7	Q01973	0.0	1956	937	1.000	1.000	ROR1_HUMAN Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Homo sapiens OX=9606 GN=ROR1 PE=1 SV=2
8	Q01974	0.0	1035	943	0.552	0.548	ROR2_HUMAN Tyrosine-protein kinase transmembrane receptor ROR2 OS=Homo sapiens OX=9606 GN=ROR2 PE=1 SV=2
9	Q8AV69	0.0	1023	930	0.554	0.558	Q8AV69_XENLA Receptor tyrosine kinase Xror2 OS=Xenopus laevis OX=8355 GN=ror2.L PE=2 SV=1
10	Q9Z138	0.0	1028	944	0.551	0.547	ROR2_MOUSE Tyrosine-protein kinase transmembrane receptor ROR2 OS=Mus musculus OX=10090 GN=Ror2 PE=1 SV=2
11	Q9Z139	0.0	1902	937	0.968	0.968	ROR1_MOUSE Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Mus musculus OX=10090 GN=Ror1 PE=2 SV=2
12	Q24488	1.97e-126	400	685	0.248	0.339	ROR1_DROME Tyrosine-protein kinase transmembrane receptor Ror OS=Drosophila melanogaster OX=7227 GN=Ror PE=1 SV=1
13	Q5J1R9	5.03e-114	374	941	0.250	0.249	Q5J1R9_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fj98e12 PE=1 SV=1
14	Q9V6K3	4.79e-111	360	724	0.232	0.300	ROR2_DROME Tyrosine-protein kinase transmembrane receptor Ror2 OS=Drosophila melanogaster OX=7227 GN=Nrk PE=1 SV=2
15	Q5J1R8	4.87e-111	358	676	0.226	0.314	Q5J1R8_DANRE Muscle, skeletal receptor tyrosine-protein kinase isoform 2 precursor OS=Danio rerio OX=7955 GN=si:dz57f23.3 PE=2 SV=1
16	Q62838	1.28e-80	281	868	0.145	0.157	MUSK_RAT Muscle, skeletal receptor tyrosine protein kinase OS=Rattus norvegicus OX=10116 GN=Musk PE=1 SV=1
17	O15146	1.39e-80	281	869	0.144	0.155	MUSK_HUMAN Muscle, skeletal receptor tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=MUSK PE=1 SV=1
18	Q61006	1.45e-80	281	868	0.145	0.157	MUSK_MOUSE Muscle, skeletal receptor tyrosine-protein kinase OS=Mus musculus OX=10090 GN=Musk PE=1 SV=1
19	A0A8I6AEX6	1.36e-78	257	234	0.130	0.521	A0A8I6AEX6_RAT Receptor tyrosine kinase-like orphan receptor 1 OS=Rattus norvegicus OX=10116 GN=Ror1 PE=1 SV=1
20	Q6B515	2.44e-75	262	669	0.144	0.202	Q6B515_TAEGU Tyrosine-protein kinase receptor (Fragment) OS=Taeniopygia guttata OX=59729 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01392 Fz	1.3e-11	56.4	Fz domain
2	PF12330 Haspin_kinase	2.4e+02	12.1	Haspin like kinase domain
3	PF07679 I-set	2.2e-13	61.4	Immunoglobulin I-set domain
4	PF00047 ig	5.4e-05	34.6	Immunoglobulin domain
5	PF13895 Ig_2	3.2e-05	35.5	Immunoglobulin domain
6	PF13927 Ig_3	2.7e-12	58.4	Immunoglobulin domain
7	PF00051 Kringle	7.4e-20	82.4	Kringle domain
8	PF00069 Pkinase	7.5e-38	142.0	Protein kinase domain
9	PF07714 PK_Tyr_Ser-Thr	1.3e-87	304.9	Protein tyrosine and serine/threonine kinase
10	PF15102 TMEM154	2e+02	13.2	TMEM154 protein family
11	PF07686 V-set	0.0045	28.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360120

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264634	0.979	Protein Wnt-5a
2	9606.ENSP00000323901	0.944	Frizzled-2
3	9606.ENSP00000354607	0.941	Frizzled-5
4	9606.ENSP00000364860	0.906	Tyrosine-protein kinase transmembrane receptor ROR2
5	9606.ENSP00000327694	0.903	AP-2 complex subunit alpha-2
6	9606.ENSP00000351926	0.903	AP-2 complex subunit alpha-1
7	9606.ENSP00000292807	0.902	AP-2 complex subunit mu
8	9606.ENSP00000242285	0.901	Clathrin light chain A
9	9606.ENSP00000263270	0.901	AP-2 complex subunit sigma
10	9606.ENSP00000309415	0.901	Clathrin light chain B
11	9606.ENSP00000482835	0.901	AP-2 complex subunit beta
12	9606.ENSP00000479606	0.900	Clathrin heavy chain 1
13	9606.ENSP00000434034	0.790	Frizzled-4
14	9606.ENSP00000229030	0.788	Frizzled-10
15	9606.ENSP00000286201	0.766	Frizzled-7
16	9606.ENSP00000345785	0.762	Frizzled-9
17	9606.ENSP00000363826	0.759	Frizzled-8
18	9606.ENSP00000287934	0.749	Frizzled-1
19	9606.ENSP00000361883	0.727	Adenylyl cyclase-associated protein 1
20	9606.ENSP00000351605	0.703	Frizzled-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004714	1.000	transmembrane receptor protein tyrosine kinase activity
GO:0017147	0.924	Wnt-protein binding
GO:0005102	0.807	signaling receptor binding
GO:0042813	0.725	Wnt receptor activity
GO:0015026	0.657	coreceptor activity
GO:0019899	0.612	enzyme binding
GO:0004674	0.302	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0048856	0.987	anatomical structure development
GO:0050789	0.985	regulation of biological process
GO:0032501	0.984	multicellular organismal process
GO:0050794	0.984	regulation of cellular process
GO:0048731	0.966	system development
GO:0030154	0.948	cell differentiation
GO:0050896	0.904	response to stimulus
GO:0048708	0.866	astrocyte differentiation
GO:0019222	0.859	regulation of metabolic process
GO:0048518	0.857	positive regulation of biological process
GO:0060255	0.850	regulation of macromolecule metabolic process
GO:0048522	0.848	positive regulation of cellular process
GO:0007165	0.847	signal transduction
GO:0080090	0.762	regulation of primary metabolic process
GO:0051171	0.762	regulation of nitrogen compound metabolic process
GO:0007166	0.742	cell surface receptor signaling pathway
GO:0048513	0.706	animal organ development
GO:0031323	0.704	regulation of cellular metabolic process
GO:0014002	0.625	astrocyte development
GO:0009893	0.572	positive regulation of metabolic process
GO:0010468	0.515	regulation of gene expression
GO:0044093	0.512	positive regulation of molecular function
GO:0010556	0.509	regulation of macromolecule biosynthetic process
GO:0048583	0.488	regulation of response to stimulus
GO:0006355	0.488	regulation of DNA-templated transcription
GO:0048519	0.485	negative regulation of biological process
GO:0010604	0.482	positive regulation of macromolecule metabolic process
GO:0009966	0.472	regulation of signal transduction
GO:0031325	0.451	positive regulation of cellular metabolic process
GO:0048584	0.439	positive regulation of response to stimulus
GO:0051173	0.429	positive regulation of nitrogen compound metabolic process
GO:0023056	0.327	positive regulation of signaling
GO:0010647	0.327	positive regulation of cell communication
GO:0009967	0.324	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0032991	0.990	protein-containing complex
GO:0005886	0.989	plasma membrane
GO:0009986	0.959	cell surface
GO:0043227	0.933	membrane-bounded organelle
GO:0043231	0.916	intracellular membrane-bounded organelle
GO:0031982	0.901	vesicle
GO:0043232	0.876	intracellular non-membrane-bounded organelle
GO:0005856	0.807	cytoskeleton
GO:0031410	0.789	cytoplasmic vesicle
GO:0032432	0.747	actin filament bundle
GO:0097517	0.675	contractile actin filament bundle
GO:0001725	0.667	stress fiber
GO:0012506	0.616	vesicle membrane
GO:0030659	0.614	cytoplasmic vesicle membrane
GO:0030139	0.593	endocytic vesicle
GO:0030666	0.571	endocytic vesicle membrane
GO:0030054	0.557	cell junction
GO:0042995	0.436	cell projection
GO:0120025	0.407	plasma membrane bounded cell projection
GO:0030136	0.392	clathrin-coated vesicle
GO:0030669	0.375	clathrin-coated endocytic vesicle membrane
GO:0005576	0.364	extracellular region
GO:0045202	0.348	synapse
GO:0005829	0.300	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]