StarFunc result for job id Q01974

User Input

>input (943 residues)
MARGSALPRRPLLCIPAVWAAAALLLSVSRTSGEVEVLDPNDPLGPLDGQDGPIPTLKGY
FLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRL
RIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGI
ACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCD
ARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANC
MRIGIPAERLGRYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGG
GHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIAC
LFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELG
EDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLL
GVVTKDQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIA
AGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMA
PEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAW
VYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSN
VSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAYGAYLPNFYPV
QIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNA
PEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FCE4	0.366	0.367	0.000	939	0.708	0.711	E7FCE4.pdb.gz	E7FCE4_DANRE Receptor tyrosine kinase-like orphan receptor 2 OS=Danio rerio OX=7955 GN=ror2 PE=1 SV=1
2	AFDB:Q8AV69	0.600	0.607	0.000	930	0.791	0.802	Q8AV69.pdb.gz	Q8AV69_XENLA Receptor tyrosine kinase Xror2 OS=Xenopus laevis OX=8355 GN=ror2.L PE=2 SV=1
3	AFDB:Q9Z138	0.523	0.522	0.000	944	0.923	0.922	Q9Z138.pdb.gz	ROR2_MOUSE Tyrosine-protein kinase transmembrane receptor ROR2 OS=Mus musculus OX=10090 GN=Ror2 PE=1 SV=2
4	AFDB:D3ZZ97	0.337	0.358	8.657E-103	874	0.554	0.597	D3ZZ97.pdb.gz	D3ZZ97_RAT Receptor tyrosine kinase-like orphan receptor 1 OS=Rattus norvegicus OX=10116 GN=Ror1 PE=3 SV=3
5	AFDB:A0A0R4ITX7	0.295	0.346	2.341E-36	801	0.192	0.226	A0A0R4ITX7.pdb.gz
6	AFDB:P30530	0.262	0.275	8.760E-30	894	0.186	0.196	P30530.pdb.gz	UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens OX=9606 GN=AXL PE=1 SV=4
7	AFDB:P55144	0.271	0.290	2.572E-29	880	0.158	0.169	P55144.pdb.gz	TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus OX=10090 GN=Tyro3 PE=1 SV=2
8	AFDB:E9PSX9	0.263	0.280	2.218E-28	879	0.171	0.183	E9PSX9.pdb.gz	E9PSX9_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
9	AFDB:E9PSY0	0.259	0.274	4.234E-28	888	0.174	0.185	E9PSY0.pdb.gz	E9PSY0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
10	AFDB:Q00993	0.279	0.295	5.251E-28	888	0.176	0.187	Q00993.pdb.gz	UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus musculus OX=10090 GN=Axl PE=1 SV=2
11	PDB:2h8hA	0.250	0.507	4.028E-22	445	0.106	0.225	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:4fl2A	0.257	0.424	2.139E-21	555	0.097	0.164	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.248	0.415	9.796E-20	551	0.098	0.167	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.250	0.521	1.895E-18	441	0.094	0.202	1k9aB.pdb.gz
15	PDB:6s73A	0.244	0.781	3.616E-14	269	0.071	0.249	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:8dksA	0.207	0.615	4.485E-14	283	0.073	0.244	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
17	PDB:6lk5A	0.237	0.767	7.283E-14	265	0.069	0.245	6lk5A.pdb.gz
18	PDB:7mfdA	0.244	0.528	9.534E-14	410	0.084	0.193	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
19	PDB:5ufuA	0.232	0.555	2.653E-13	369	0.070	0.179	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:1blxA	0.221	0.623	4.798E-13	305	0.070	0.216	1blxA.pdb.gz	Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZQX3	0.0	1026	873	0.527	0.569	A0A8I5ZQX3_RAT Receptor tyrosine kinase-like orphan receptor 1 OS=Rattus norvegicus OX=10116 GN=Ror1 PE=1 SV=1
2	A0A8I5ZRJ7	0.0	1716	931	0.909	0.921	A0A8I5ZRJ7_RAT Receptor tyrosine kinase-like orphan receptor 2 OS=Rattus norvegicus OX=10116 GN=Ror2 PE=3 SV=1
3	A1L4F5	0.0	1968	943	0.998	0.998	A1L4F5_HUMAN Receptor tyrosine kinase-like orphan receptor 2 OS=Homo sapiens OX=9606 GN=ROR2 PE=1 SV=1
4	D3ZNY8	0.0	1748	943	0.922	0.922	D3ZNY8_RAT Receptor tyrosine kinase-like orphan receptor 2 OS=Rattus norvegicus OX=10116 GN=Ror2 PE=3 SV=1
5	D3ZZ97	0.0	1041	937	0.531	0.535	D3ZZ97_RAT Receptor tyrosine kinase-like orphan receptor 1 OS=Rattus norvegicus OX=10116 GN=Ror1 PE=3 SV=3
6	E7FCE4	0.0	1355	939	0.707	0.710	E7FCE4_DANRE Receptor tyrosine kinase-like orphan receptor 2 OS=Danio rerio OX=7955 GN=ror2 PE=1 SV=1
7	Q01973	0.0	1041	937	0.528	0.531	ROR1_HUMAN Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Homo sapiens OX=9606 GN=ROR1 PE=1 SV=2
8	Q01974	0.0	1969	943	1.000	1.000	ROR2_HUMAN Tyrosine-protein kinase transmembrane receptor ROR2 OS=Homo sapiens OX=9606 GN=ROR2 PE=1 SV=2
9	Q8AV69	0.0	1502	930	0.788	0.799	Q8AV69_XENLA Receptor tyrosine kinase Xror2 OS=Xenopus laevis OX=8355 GN=ror2.L PE=2 SV=1
10	Q9Z138	0.0	1743	944	0.924	0.923	ROR2_MOUSE Tyrosine-protein kinase transmembrane receptor ROR2 OS=Mus musculus OX=10090 GN=Ror2 PE=1 SV=2
11	Q9Z139	0.0	1043	937	0.531	0.535	ROR1_MOUSE Inactive tyrosine-protein kinase transmembrane receptor ROR1 OS=Mus musculus OX=10090 GN=Ror1 PE=2 SV=2
12	Q24488	2.24e-118	379	685	0.229	0.315	ROR1_DROME Tyrosine-protein kinase transmembrane receptor Ror OS=Drosophila melanogaster OX=7227 GN=Ror PE=1 SV=1
13	Q5J1R9	1.30e-112	370	941	0.248	0.249	Q5J1R9_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fj98e12 PE=1 SV=1
14	Q5J1R8	5.20e-108	351	676	0.216	0.302	Q5J1R8_DANRE Muscle, skeletal receptor tyrosine-protein kinase isoform 2 precursor OS=Danio rerio OX=7955 GN=si:dz57f23.3 PE=2 SV=1
15	G5EGK5	1.31e-74	266	928	0.141	0.143	CAM1_CAEEL Tyrosine-protein kinase receptor cam-1 OS=Caenorhabditis elegans OX=6239 GN=cam-1 PE=1 SV=1
16	Q61006	2.82e-74	264	868	0.127	0.138	MUSK_MOUSE Muscle, skeletal receptor tyrosine-protein kinase OS=Mus musculus OX=10090 GN=Musk PE=1 SV=1
17	Q62838	2.88e-74	264	868	0.127	0.138	MUSK_RAT Muscle, skeletal receptor tyrosine protein kinase OS=Rattus norvegicus OX=10116 GN=Musk PE=1 SV=1
18	O15146	6.66e-74	263	869	0.130	0.142	MUSK_HUMAN Muscle, skeletal receptor tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=MUSK PE=1 SV=1
19	A0A0R4ILA2	2.13e-72	257	799	0.136	0.160	A0A0R4ILA2_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=si:ch211-220b11.1 PE=3 SV=1
20	Q6B515	1.25e-70	249	669	0.133	0.187	Q6B515_TAEGU Tyrosine-protein kinase receptor (Fragment) OS=Taeniopygia guttata OX=59729 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	1.5e+02	13.8	CD80-like C2-set immunoglobulin domain
2	PF01392 Fz	4.6e-12	57.9	Fz domain
3	PF07679 I-set	1.1e-14	65.6	Immunoglobulin I-set domain
4	PF00047 ig	0.0039	28.7	Immunoglobulin domain
5	PF13895 Ig_2	2.4e-05	35.9	Immunoglobulin domain
6	PF13927 Ig_3	1.5e-11	56.0	Immunoglobulin domain
7	PF00051 Kringle	2.6e-20	83.8	Kringle domain
8	PF00069 Pkinase	2.8e-34	130.3	Protein kinase domain
9	PF07714 PK_Tyr_Ser-Thr	1.6e-83	291.5	Protein tyrosine and serine/threonine kinase
10	PF07686 V-set	0.011	27.3	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364860

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264634	0.997	Protein Wnt-5a
2	9606.ENSP00000284523	0.972	Protein Wnt-3a
3	9606.ENSP00000323901	0.971	Frizzled-2
4	9606.ENSP00000354607	0.968	Frizzled-5
5	9606.ENSP00000368169	0.965	Segment polarity protein dishevelled homolog DVL-1
6	9606.ENSP00000286201	0.962	Frizzled-7
7	9606.ENSP00000294304	0.960	Low-density lipoprotein receptor-related protein 5
8	9606.ENSP00000434034	0.960	Frizzled-4
9	9606.ENSP00000005340	0.954	Segment polarity protein dishevelled homolog DVL-2
10	9606.ENSP00000316054	0.951	Segment polarity protein dishevelled homolog DVL-3
11	9606.ENSP00000358866	0.947	Filamin-A
12	9606.ENSP00000351605	0.944	Frizzled-6
13	9606.ENSP00000357040	0.928	Vang-like protein 2
14	9606.ENSP00000330523	0.922	Collagen triple helix repeat-containing protein 1
15	9606.ENSP00000378974	0.915	Mitogen-activated protein kinase 8
16	9606.ENSP00000348461	0.911	Ras-related C3 botulinum toxin substrate 1
17	9606.ENSP00000352157	0.911	Mitogen-activated protein kinase 10
18	9606.ENSP00000394560	0.909	Mitogen-activated protein kinase 9
19	9606.ENSP00000360120	0.906	Inactive tyrosine-protein kinase transmembrane receptor ROR1
20	9606.ENSP00000351926	0.904	AP-2 complex subunit alpha-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	0.999	Wnt-protein binding
GO:0004714	0.998	transmembrane receptor protein tyrosine kinase activity
GO:0019901	0.978	protein kinase binding
GO:0005102	0.947	signaling receptor binding
GO:0042802	0.659	identical protein binding
GO:0031435	0.620	mitogen-activated protein kinase kinase kinase binding
GO:0005109	0.501	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.981	regulation of cellular process
GO:0032501	0.978	multicellular organismal process
GO:0048856	0.978	anatomical structure development
GO:0009987	0.976	cellular process
GO:0048522	0.966	positive regulation of cellular process
GO:0050896	0.964	response to stimulus
GO:0048731	0.957	system development
GO:0019222	0.956	regulation of metabolic process
GO:0023052	0.951	signaling
GO:0007154	0.947	cell communication
GO:0030154	0.945	cell differentiation
GO:0051171	0.937	regulation of nitrogen compound metabolic process
GO:0080090	0.926	regulation of primary metabolic process
GO:0048583	0.925	regulation of response to stimulus
GO:0031323	0.923	regulation of cellular metabolic process
GO:0060255	0.907	regulation of macromolecule metabolic process
GO:0048708	0.886	astrocyte differentiation
GO:1903506	0.879	regulation of nucleic acid-templated transcription
GO:0023051	0.866	regulation of signaling
GO:0043410	0.860	positive regulation of MAPK cascade
GO:0045859	0.845	regulation of protein kinase activity
GO:0071900	0.833	regulation of protein serine/threonine kinase activity
GO:0048513	0.825	animal organ development
GO:0042327	0.825	positive regulation of phosphorylation
GO:0045860	0.817	positive regulation of protein kinase activity
GO:0051240	0.815	positive regulation of multicellular organismal process
GO:0010468	0.807	regulation of gene expression
GO:0043406	0.805	positive regulation of MAP kinase activity
GO:0007166	0.797	cell surface receptor signaling pathway
GO:0043507	0.794	positive regulation of JUN kinase activity
GO:0051094	0.716	positive regulation of developmental process
GO:0048519	0.710	negative regulation of biological process
GO:0006355	0.691	regulation of DNA-templated transcription
GO:0014002	0.678	astrocyte development
GO:0048523	0.591	negative regulation of cellular process
GO:0007267	0.531	cell-cell signaling
GO:0048806	0.501	genitalia development
GO:0051966	0.470	regulation of synaptic transmission, glutamatergic
GO:1905114	0.437	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0198738	0.411	cell-cell signaling by wnt
GO:0016055	0.404	Wnt signaling pathway
GO:0045595	0.390	regulation of cell differentiation
GO:0051128	0.384	regulation of cellular component organization
GO:0009888	0.380	tissue development
GO:0009891	0.303	positive regulation of biosynthetic process
GO:0009653	0.301	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.998	cytoplasm
GO:0043229	0.997	intracellular organelle
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0030054	0.977	cell junction
GO:0031982	0.968	vesicle
GO:0009986	0.961	cell surface
GO:0097708	0.951	intracellular vesicle
GO:0031410	0.942	cytoplasmic vesicle
GO:0030139	0.911	endocytic vesicle
GO:0031090	0.890	organelle membrane
GO:0043232	0.883	intracellular non-membrane-bounded organelle
GO:0030659	0.883	cytoplasmic vesicle membrane
GO:0098588	0.868	bounding membrane of organelle
GO:0030666	0.814	endocytic vesicle membrane
GO:0005856	0.799	cytoskeleton
GO:0012505	0.712	endomembrane system
GO:0043005	0.660	neuron projection
GO:0099513	0.654	polymeric cytoskeletal fiber
GO:0032991	0.650	protein-containing complex
GO:0036477	0.645	somatodendritic compartment
GO:0045202	0.627	synapse
GO:0044297	0.388	cell body
GO:0098794	0.366	postsynapse
GO:0030425	0.337	dendrite
GO:0005576	0.325	extracellular region
GO:0005829	0.309	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.998	receptor protein-tyrosine kinase.

[back to server]