StarFunc result for job id Q02040

User Input

>input (695 residues)
MAAATIVHDTSEAVELCPAYGLYLKPITKMTISVALPQLKQPGKSISNWEVMERLKGMVQ
NHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKID
FPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPCKWFALKESGSEKPSEDVLVKVFEK
FGEIRNVDIPMLDPYREEMTGRNFHTFSFGGHLNFEAYVQYREYMGFIQAMSALRGMKLM
YKGEDGKAVACNIKVSFDSTKHLSDASIKKRQLERQKLQELEQQREEQKRREKEAEERQR
AEERKQKELEELERERKREEKLRKREQKQRDRELRRNQKKLEKLQAEEQKQLQEKIKLEE
RKLLLAQRNLQSIRLIAELLSRAKAVKLREQEQKEEKLRLQQQEERRRLQEAELRRVEEE
KERALGLQRKERELRERLLSILLSKKPDDSHTHDELGVAHADLLQPVLDILQTVSSGCVS
ATTLHPLGGQPPAGAPKESPAHPEADGAPKSVNGSVAEEAPCKEVQSSCRVVPEDGSPEK
RCPGGVLSCIPDNNQQPKGIPACEQNVSRKDTRSEQDKCNREPSKGRGRATGDGLADRHK
RERSRARRASSREDGRPRKERRPHKKHAYKDDSPRRRSTSPDHTRSRRSHSKDRHRRERS
RERRGSASRKHSRHRRRSERSRSRSPSRHRSTWNR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02040	1.000	1.000	8.835E-103	695	1.000	1.000	Q02040.pdb.gz	AK17A_HUMAN A-kinase anchor protein 17A OS=Homo sapiens OX=9606 GN=AKAP17A PE=1 SV=2
2	PDB:5vsuA	0.115	0.197	1.017E-5	387	0.052	0.093	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
3	PDB:7evoD	0.096	0.295	2.202E-4	200	0.049	0.170	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
4	PDB:3q08A	0.092	0.204	2.116E-3	241	0.040	0.116	3q08A.pdb.gz	Structural features promoting dioxygen production by Dechloromonas aromatica chlorite dismutase.
5	PDB:5lsbA	0.091	0.307	2.998E-3	176	0.047	0.188	5lsbA.pdb.gz
6	PDB:6w6vE	0.087	0.272	4.769E-3	169	0.020	0.083	6w6vE.pdb.gz	Cryo-EM structure of catalytic ribonucleoprotein complex RNase MRP.
7	PDB:6fyxp	0.099	0.106	7.158E-3	647	0.022	0.023	6fyxp.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
8	PDB:6y5qq	0.095	0.298	8.039E-3	178	0.049	0.191	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
9	PDB:5it0A	0.082	0.132	8.519E-3	396	0.036	0.063	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
10	PDB:6ff7X	0.102	0.361	9.028E-3	171	0.043	0.175	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
11	PDB:6agbH	0.103	0.419	4.081E-2	131	0.010	0.053	6agbH.pdb.gz	Structural insight into precursor tRNA processing by yeast ribonuclease P.
12	AFDB:A0A0G2K490	0.102	0.058	7.488E-2	1360	0.141	0.072	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
13	AFDB:A0A0R4IEP9	0.131	0.073	1.061E-1	1332	0.137	0.071	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
14	AFDB:M9MRX0	0.188	0.139	2.008E-1	989	0.140	0.098	M9MRX0.pdb.gz	M9MRX0_DROME Limpet, isoform J OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1
15	AFDB:D3YXK2	0.100	0.077	2.255E-1	937	0.135	0.100	D3YXK2.pdb.gz	SAFB1_MOUSE Scaffold attachment factor B1 OS=Mus musculus OX=10090 GN=Safb PE=1 SV=2
16	AFDB:A0MZ67	0.063	0.067	2.844E-1	633	0.095	0.104	A0MZ67.pdb.gz	SHOT1_RAT Shootin-1 OS=Rattus norvegicus OX=10116 GN=Shtn1 PE=1 SV=1
17	AFDB:P49455	0.187	0.238	3.014E-1	518	0.099	0.133	P49455.pdb.gz	TPM4_DROME Tropomyosin-1, isoforms 33/34 OS=Drosophila melanogaster OX=7227 GN=Tm1 PE=2 SV=2
18	AFDB:F1QCK8	0.132	0.095	3.587E-1	1012	0.089	0.061	F1QCK8.pdb.gz	F1QCK8_DANRE Rho guanine nucleotide exchange factor 18 isoform X2 OS=Danio rerio OX=7955 GN=arhgef18b PE=1 SV=2
19	AFDB:Q9C7B1	0.052	0.057	3.802E-1	619	0.075	0.084	Q9C7B1.pdb.gz	TRP3_ARATH Telomere repeat-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=TRP3 PE=1 SV=1
20	AFDB:P83510	0.108	0.064	4.029E-1	1323	0.118	0.062	P83510.pdb.gz	TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus OX=10090 GN=Tnik PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q02040	0.0	1413	695	1.000	1.000	AK17A_HUMAN A-kinase anchor protein 17A OS=Homo sapiens OX=9606 GN=AKAP17A PE=1 SV=2
2	Q8IDX6	6.52e-14	78.2	3130	0.072	0.016	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
3	C0H5F4	0.002	44.3	3254	0.046	0.010	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2
4	A8DYA3	0.017	41.2	3131	0.075	0.017	A8DYA3_DROME Toutatis, isoform E OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
5	A1Z8M2	0.018	41.2	2999	0.075	0.017	A1Z8M2_DROME Toutatis, isoform A OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=2
6	Q5DU05	0.037	40.0	1446	0.091	0.044	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
7	Q95R61	0.054	38.9	310	0.052	0.116	Q95R61_DROME SD04909p OS=Drosophila melanogaster OX=7227 GN=Incenp PE=2 SV=1
8	Q8IGP7	0.069	38.9	781	0.052	0.046	Q8IGP7_DROME RE52507p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Incenp PE=2 SV=1
9	Q7JRJ9	0.075	38.9	755	0.052	0.048	Q7JRJ9_DROME Inner centromere protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Incenp PE=1 SV=1
10	A0A0B4LFQ2	0.077	38.9	754	0.052	0.048	A0A0B4LFQ2_DROME Inner centromere protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Incenp PE=1 SV=1
11	Q1WWC9	0.086	38.5	1096	0.059	0.037	Q1WWC9_DROME Dynamin associated protein 160, isoform C OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
12	M9PBF6	0.094	38.5	1088	0.059	0.038	M9PBF6_DROME Dynamin associated protein 160, isoform G OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
13	M9PDC7	0.098	38.5	1005	0.059	0.041	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
14	Q9VIF7	0.098	38.5	1097	0.059	0.037	Q9VIF7_DROME Dynamin associated protein 160, isoform A OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
15	Q8INU2	0.099	38.5	1014	0.059	0.040	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
16	M9ND00	0.10	38.5	1190	0.059	0.034	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
17	O61618	0.100	38.5	1094	0.059	0.037	O61618_DROME Dynamin associated protein isoform Dap160-1 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
18	O61639	0.11	38.5	1011	0.059	0.041	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
19	Q98TZ8	0.11	38.1	428	0.055	0.089	FLOT2_DANRE Flotillin-2a OS=Danio rerio OX=7955 GN=flot2a PE=2 SV=2
20	A0A0B4KEM1	0.12	38.5	3094	0.045	0.010	A0A0B4KEM1_DROME Toutatis, isoform G OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	10	17.4	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324827

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000289359	0.762	MIT domain-containing protein 1
2	9606.ENSP00000350409	0.732	Protein unc-50 homolog
3	9606.ENSP00000445905	0.732	EVI5-like protein
4	9606.ENSP00000387111	0.728	annotation not available
5	9606.ENSP00000283148	0.720	UDP-glucuronic acid decarboxylase 1
6	9606.ENSP00000345968	0.701	N-acetylmuramoyl-L-alanine amidase
7	9606.ENSP00000338967	0.687	Rho GTPase-activating protein 6
8	9606.ENSP00000359958	0.683	Zinc finger Ran-binding domain-containing protein 2
9	9606.ENSP00000289371	0.675	Eukaryotic translation initiation factor 5B
10	9606.ENSP00000356849	0.673	Pogo transposable element derived with KRAB domain
11	9606.ENSP00000217971	0.666	Membrane-associated progesterone receptor component 1
12	9606.ENSP00000264255	0.666	Thioredoxin domain-containing protein 9
13	9606.ENSP00000376304	0.642	Transmembrane protein 121
14	9606.ENSP00000337618	0.640	Magnesium transporter NIPA2
15	9606.ENSP00000370718	0.620	N-acetylserotonin O-methyltransferase-like protein
16	9606.ENSP00000384670	0.619	Acrosomal protein KIAA1210
17	9606.ENSP00000405252	0.619	A-kinase anchor protein 7 isoform gamma
18	9606.ENSP00000316598	0.606	Putative GTP-binding protein 6
19	9606.ENSP00000369431	0.605	Caspase activity and apoptosis inhibitor 1
20	9606.ENSP00000369465	0.605	Gamma-taxilin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051018	1.000	protein kinase A binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0051171	0.978	regulation of nitrogen compound metabolic process
GO:0080090	0.977	regulation of primary metabolic process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0010468	0.962	regulation of gene expression
GO:0043484	0.918	regulation of RNA splicing
GO:0009987	0.693	cellular process
GO:0050896	0.322	response to stimulus
GO:0071704	0.318	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016607	0.995	nuclear speck
GO:0016020	0.861	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]