StarFunc result for job id Q02045

User Input

>input (173 residues)
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02045	1.000	1.000	1.367E-27	173	1.000	1.000	Q02045.pdb.gz	MYL5_HUMAN Myosin light chain 5 OS=Homo sapiens OX=9606 GN=MYL5 PE=2 SV=1
2	AFDB:Q7T2Y1	0.861	0.866	3.275E-19	172	0.682	0.686	Q7T2Y1.pdb.gz
3	AFDB:Q01449	0.847	0.838	1.203E-18	175	0.642	0.634	Q01449.pdb.gz	MLRA_HUMAN Myosin regulatory light chain 2, atrial isoform OS=Homo sapiens OX=9606 GN=MYL7 PE=1 SV=1
4	AFDB:P04466	0.858	0.878	1.509E-18	169	0.578	0.592	P04466.pdb.gz	MYL11_RAT Myosin regulatory light chain 11 OS=Rattus norvegicus OX=10116 GN=Myl11 PE=1 SV=2
5	AFDB:P08733	0.749	0.776	4.678E-18	166	0.618	0.645	P08733.pdb.gz	MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus OX=10116 GN=Myl2 PE=1 SV=2
6	AFDB:Q62082	0.548	0.477	4.678E-18	202	0.636	0.545	Q62082.pdb.gz	MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus OX=10090 GN=Myl10 PE=2 SV=1
7	AFDB:A0A060WU79	0.646	0.571	6.952E-18	200	0.659	0.570	A0A060WU79.pdb.gz	A0A060WU79_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039796001 PE=4 SV=1
8	AFDB:A7XZM2	0.754	0.766	1.033E-17	170	0.572	0.582	A7XZM2.pdb.gz	A7XZM2_ONCMY Fast myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
9	AFDB:P40423	0.831	0.826	1.112E-16	174	0.514	0.511	P40423.pdb.gz	SQH_DROME Myosin regulatory light chain sqh OS=Drosophila melanogaster OX=7227 GN=sqh PE=1 SV=1
10	AFDB:A0A0G2JSW0	0.823	0.827	1.395E-16	172	0.543	0.547	A0A0G2JSW0.pdb.gz	A0A0G2JSW0_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12b PE=4 SV=2
11	PDB:7qioP	0.441	0.517	6.228E-12	143	0.514	0.622	7qioP.pdb.gz
12	PDB:7mf3D	0.771	0.836	1.300E-11	158	0.486	0.532	7mf3D.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
13	PDB:5tbyE	0.537	0.569	2.712E-11	160	0.584	0.631	5tbyE.pdb.gz
14	PDB:1i84U	0.675	0.824	8.408E-11	138	0.451	0.565	1i84U.pdb.gz
15	PDB:3wfnB	0.410	0.418	5.322E-8	169	0.301	0.308	3wfnB.pdb.gz
16	PDB:1osaA	0.444	0.506	4.318E-7	148	0.295	0.345	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
17	PDB:1ggzA	0.466	0.548	7.603E-7	144	0.277	0.333	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
18	PDB:1m46A	0.386	0.445	1.880E-6	148	0.202	0.236	1m46A.pdb.gz	Two distinct myosin light chain structures are induced by specific variations within the bound IQ motifs-functional implications
19	PDB:5a2hA	0.474	0.548	2.358E-6	147	0.301	0.354	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
20	PDB:1a2xA	0.337	0.363	2.495E-6	158	0.208	0.228	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q02045	6.71e-125	350	173	1.000	1.000	MYL5_HUMAN Myosin light chain 5 OS=Homo sapiens OX=9606 GN=MYL5 PE=2 SV=1
2	Q801M3	1.34e-82	243	172	0.688	0.692	Q801M3_DANRE Myosin light chain 2 Mlc2a OS=Danio rerio OX=7955 GN=cmlc2 PE=1 SV=1
3	Q9QVP4	1.05e-79	236	175	0.642	0.634	MLRA_MOUSE Myosin regulatory light chain 2, atrial isoform OS=Mus musculus OX=10090 GN=Myl7 PE=1 SV=1
4	Q01449	3.74e-79	234	175	0.642	0.634	MLRA_HUMAN Myosin regulatory light chain 2, atrial isoform OS=Homo sapiens OX=9606 GN=MYL7 PE=1 SV=1
5	P10916	8.95e-79	233	166	0.636	0.663	MLRV_HUMAN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Homo sapiens OX=9606 GN=MYL2 PE=1 SV=3
6	P51667	1.40e-77	230	166	0.636	0.663	MLRV_MOUSE Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Mus musculus OX=10090 GN=Myl2 PE=1 SV=3
7	P08733	4.61e-77	229	166	0.630	0.657	MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus OX=10116 GN=Myl2 PE=1 SV=2
8	Q62082	2.77e-76	228	202	0.636	0.545	MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus OX=10090 GN=Myl10 PE=2 SV=1
9	P02609	4.30e-75	224	168	0.607	0.625	MYL11_CHICK Myosin regulatory light chain 11 OS=Gallus gallus OX=9031 GN=MYL11 PE=1 SV=2
10	A0A060WU79	3.81e-74	223	200	0.618	0.535	A0A060WU79_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039796001 PE=4 SV=1
11	A7XZM0	1.48e-73	220	168	0.613	0.631	A7XZM0_ONCMY Slow myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
12	O93409	2.55e-73	219	169	0.595	0.609	MLRSA_DANRE Myosin regulatory light chain 2, skeletal muscle isoform A OS=Danio rerio OX=7955 GN=mylpfa PE=1 SV=1
13	P97457	2.21e-72	217	169	0.584	0.598	MYL11_MOUSE Myosin regulatory light chain 11 OS=Mus musculus OX=10090 GN=Myl11 PE=1 SV=3
14	P04466	5.72e-72	216	169	0.584	0.598	MYL11_RAT Myosin regulatory light chain 11 OS=Rattus norvegicus OX=10116 GN=Myl11 PE=1 SV=2
15	Q96A32	9.95e-71	213	169	0.584	0.598	MYL11_HUMAN Myosin regulatory light chain 11 OS=Homo sapiens OX=9606 GN=MYL11 PE=1 SV=1
16	A7XZM2	2.88e-70	212	170	0.590	0.600	A7XZM2_ONCMY Fast myosin light chain 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
17	A0A060WH27	5.49e-70	210	149	0.584	0.678	A0A060WH27_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00071433001 PE=4 SV=1
18	Q9BUA6	1.23e-69	212	226	0.636	0.487	MYL10_HUMAN Myosin regulatory light chain 10 OS=Homo sapiens OX=9606 GN=MYL10 PE=1 SV=2
19	Q9I9H9	1.59e-67	205	170	0.566	0.576	Q9I9H9_ONCKI Myosin light chain 2 OS=Oncorhynchus kisutch OX=8019 PE=2 SV=1
20	A0A060XEV5	3.29e-65	198	149	0.520	0.604	A0A060XEV5_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00044007001 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05042 Caleosin	1.4e+02	13.8	Caleosin related protein
2	PF00036 EF-hand_1	6.2e-09	45.8	EF hand
3	PF13202 EF-hand_5	0.0002	31.9	EF hand
4	PF13405 EF-hand_6	5.5e-08	43.0	EF-hand domain
5	PF13499 EF-hand_7	1.1e-10	53.2	EF-hand domain pair
6	PF13833 EF-hand_8	5.6e-05	34.2	EF-hand domain pair
7	PF01441 Lipoprotein_6	1.3e+02	14.0	Lipoprotein
8	PF10591 SPARC_Ca_bdg	4.9e+02	12.5	Secreted protein acidic and rich in cysteine Ca binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383023

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353452	0.978	Myosin light chain kinase, smooth muscle
2	9606.ENSP00000353590	0.955	Myosin-10
3	9606.ENSP00000404570	0.948	Myosin-13
4	9606.ENSP00000384330	0.947	Myosin-8
5	9606.ENSP00000470298	0.947	Myosin-14
6	9606.ENSP00000226207	0.944	Myosin-1
7	9606.ENSP00000245503	0.944	Myosin-2
8	9606.ENSP00000255381	0.944	Myosin-4
9	9606.ENSP00000464317	0.944	Myosin-3
10	9606.ENSP00000347507	0.938	Myosin-7
11	9606.ENSP00000216181	0.937	Myosin-9
12	9606.ENSP00000386041	0.933	Myosin-6
13	9606.ENSP00000446955	0.933	Myosin light polypeptide 6
14	9606.ENSP00000379616	0.932	Myosin-11
15	9606.ENSP00000450385	0.930	Myosin light chain 6B
16	9606.ENSP00000279022	0.903	Myosin regulatory light polypeptide 9
17	9606.ENSP00000223167	0.902	Myosin regulatory light chain 10
18	9606.ENSP00000463559	0.901	Myosin regulatory light chain 12B
19	9606.ENSP00000217652	0.900	Myosin regulatory light chain 12A
20	9606.ENSP00000223364	0.900	Myosin regulatory light chain 2, atrial isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008307	0.999	structural constituent of muscle
GO:0043167	0.693	ion binding
GO:0008092	0.452	cytoskeletal protein binding
GO:0043169	0.304	cation binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0009987	0.970	cellular process
GO:0044057	0.961	regulation of system process
GO:0032501	0.943	multicellular organismal process
GO:0032502	0.673	developmental process
GO:0048856	0.639	anatomical structure development
GO:0071840	0.462	cellular component organization or biogenesis
GO:0003008	0.429	system process
GO:0016043	0.429	cellular component organization
GO:0030029	0.410	actin filament-based process
GO:0048518	0.404	positive regulation of biological process
GO:0003012	0.399	muscle system process
GO:0007275	0.397	multicellular organism development
GO:0009653	0.395	anatomical structure morphogenesis
GO:0050794	0.388	regulation of cellular process
GO:0006936	0.381	muscle contraction
GO:0050896	0.321	response to stimulus
GO:0061061	0.318	muscle structure development
GO:0048513	0.312	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0099080	0.999	supramolecular complex
GO:0005829	0.992	cytosol
GO:0032991	0.988	protein-containing complex
GO:0099512	0.986	supramolecular fiber
GO:0043292	0.963	contractile fiber
GO:0015629	0.935	actin cytoskeleton
GO:0030016	0.851	myofibril
GO:0043227	0.780	membrane-bounded organelle
GO:0016459	0.770	myosin complex
GO:0016460	0.648	myosin II complex
GO:0030017	0.371	sarcomere
GO:0043231	0.321	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]