StarFunc result for job id Q02078

User Input

>input (507 residues)
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINE
EFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSML
SPPQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIG
ATGANSLGKVMPTKSPPPPGGGNLGMNSRKPDLRVVIPPSSKGMMPPLSEEEELELNTQR
ISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFNSPGMLS
LGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQ
QQQQQQQQQQPPPPPQPQPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSP
IVLGRPPNTEDRESPSVKRMRMDAWVT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02078	0.999	0.999	1.044E-70	507	1.000	1.000	Q02078.pdb.gz	MEF2A_HUMAN Myocyte-specific enhancer factor 2A OS=Homo sapiens OX=9606 GN=MEF2A PE=1 SV=1
2	AFDB:Q1LXH5	0.201	0.208	2.801E-53	488	0.793	0.824	Q1LXH5.pdb.gz
3	AFDB:Q03414	0.184	0.181	2.999E-53	516	0.805	0.791	Q03414.pdb.gz	MEF2A_XENLA Myocyte-specific enhancer factor 2A homolog OS=Xenopus laevis OX=8355 GN=mef2a PE=1 SV=2
4	AFDB:Q1LXH4	0.189	0.182	3.534E-51	524	0.771	0.746	Q1LXH4.pdb.gz
5	AFDB:A0A2R8QU09	0.194	0.210	1.766E-47	467	0.714	0.775	A0A2R8QU09.pdb.gz
6	AFDB:Q9PSD8	0.184	0.244	7.502E-41	382	0.596	0.791	Q9PSD8.pdb.gz	Q9PSD8_XENLA DNA binding protein MEF2 OS=Xenopus laevis OX=8355 PE=4 SV=1
7	AFDB:Q8CFN5	0.246	0.258	1.145E-39	474	0.604	0.646	Q8CFN5.pdb.gz	MEF2C_MOUSE Myocyte-specific enhancer factor 2C OS=Mus musculus OX=10090 GN=Mef2c PE=1 SV=2
8	AFDB:F1Q910	0.221	0.213	2.456E-38	529	0.596	0.571	F1Q910.pdb.gz
9	AFDB:Q14814	0.209	0.203	1.260E-37	521	0.560	0.545	Q14814.pdb.gz	MEF2D_HUMAN Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D PE=1 SV=1
10	AFDB:A0A0R4ITE5	0.253	0.263	1.485E-35	483	0.550	0.578	A0A0R4ITE5.pdb.gz
11	PDB:1fp1D	0.065	0.090	3.689E-1	340	0.036	0.053	1fp1D.pdb.gz	Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.
12	PDB:7ls2Q2	0.049	0.180	4.845E-1	110	0.026	0.118	7ls2Q2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
13	PDB:3zqqC	0.050	0.139	5.187E-1	134	0.024	0.090	3zqqC.pdb.gz
14	PDB:7qooP	0.064	0.122	5.552E-1	233	0.026	0.056	7qooP.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
15	PDB:3zqjF	0.056	0.048	6.363E-1	607	0.020	0.016	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action
16	PDB:1cofA	0.063	0.177	6.812E-1	135	0.032	0.119	1cofA.pdb.gz
17	PDB:8cxm0	0.071	0.118	8.946E-1	267	0.028	0.052	8cxm0.pdb.gz
18	PDB:2jkfA	0.047	0.103	1.097	170	0.006	0.018	2jkfA.pdb.gz
19	PDB:6bk8E	0.059	0.153	1.175	186	0.037	0.102	6bk8E.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
20	PDB:7m2wF	0.071	0.057	1.175	674	0.032	0.024	7m2wF.pdb.gz	CM1-driven assembly and activation of yeast gamma-tubulin small complex underlies microtubule nucleation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D9SGI5	0.0	536	471	0.635	0.684	A0A0D9SGI5_HUMAN Myocyte enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
2	A0A0R4IRM3	0.0	682	460	0.753	0.830	A0A0R4IRM3_DANRE Myocyte enhancer factor 2aa OS=Danio rerio OX=7955 GN=etID309779.18 PE=4 SV=1
3	A0A0S2Z417	0.0	813	497	0.923	0.942	A0A0S2Z417_HUMAN Myocyte enhancer factor 2A isoform 4 (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
4	A0A0S2Z454	0.0	1006	499	0.984	1.000	A0A0S2Z454_HUMAN MADS box transcription enhancer factor 2, polypeptide A (Myocyte enhancer factor 2A), isoform CRA_b (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
5	A0A0S2Z4C8	0.0	625	429	0.753	0.890	A0A0S2Z4C8_HUMAN Myocyte enhancer factor 2A isoform 5 (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
6	A0A0S2Z4N0	0.0	818	505	0.939	0.943	A0A0S2Z4N0_HUMAN MADS box transcription enhancer factor 2, polypeptide A (Myocyte enhancer factor 2A), isoform CRA_d (Fragment) OS=Homo sapiens OX=9606 GN=MEF2A PE=2 SV=1
7	Q02078	0.0	1030	507	1.000	1.000	MEF2A_HUMAN Myocyte-specific enhancer factor 2A OS=Homo sapiens OX=9606 GN=MEF2A PE=1 SV=1
8	Q03414	0.0	749	516	0.803	0.789	MEF2A_XENLA Myocyte-specific enhancer factor 2A homolog OS=Xenopus laevis OX=8355 GN=mef2a PE=1 SV=2
9	Q1LXH6	0.0	612	458	0.698	0.773	Q1LXH6_DANRE Myocyte enhancer factor 2aa OS=Danio rerio OX=7955 GN=etID309779.18 PE=4 SV=1
10	Q2MJT0	0.0	844	495	0.931	0.954	MEF2A_RAT Myocyte-specific enhancer factor 2A OS=Rattus norvegicus OX=10116 GN=Mef2a PE=1 SV=1
11	Q60929	0.0	783	498	0.893	0.910	MEF2A_MOUSE Myocyte-specific enhancer factor 2A OS=Mus musculus OX=10090 GN=Mef2a PE=1 SV=2
12	Q9PSD8	0.0	577	382	0.602	0.798	Q9PSD8_XENLA DNA binding protein MEF2 OS=Xenopus laevis OX=8355 PE=4 SV=1
13	Q98870	1.80e-176	508	529	0.606	0.580	Q98870_DANRE Myocyte enhancer factor 2D MEF2D OS=Danio rerio OX=7955 GN=mef2D PE=2 SV=1
14	A0A2R8QP40	8.07e-168	484	472	0.564	0.606	A0A2R8QP40_DANRE Myocyte enhancer factor 2cb OS=Danio rerio OX=7955 GN=si:ch211-202e12.2 PE=4 SV=1
15	A0A0D9SFD0	1.52e-167	482	431	0.588	0.691	A0A0D9SFD0_HUMAN MADS box transcription enhancer factor 2, polypeptide C (Myocyte enhancer factor 2C), isoform CRA_e OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
16	A0A096MJY4	1.74e-165	478	473	0.604	0.647	MEF2C_RAT Myocyte-specific enhancer factor 2C OS=Rattus norvegicus OX=10116 GN=Mef2c PE=1 SV=1
17	Q06413	1.89e-165	478	473	0.604	0.647	MEF2C_HUMAN Myocyte-specific enhancer factor 2C OS=Homo sapiens OX=9606 GN=MEF2C PE=1 SV=1
18	Q8CFN5	2.00e-165	478	474	0.604	0.646	MEF2C_MOUSE Myocyte-specific enhancer factor 2C OS=Mus musculus OX=10090 GN=Mef2c PE=1 SV=2
19	A2BGA7	1.60e-162	471	474	0.564	0.603	A2BGA7_DANRE Myocyte enhancer factor 2cb OS=Danio rerio OX=7955 GN=si:ch211-202e12.2 PE=4 SV=1
20	Q14814	3.19e-162	472	521	0.558	0.543	MEF2D_HUMAN Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12347 HJURP_C	1.9e-16	71.1	Holliday junction regulator protein family C-terminal repeat
2	PF00319 SRF-TF	7.5e-21	84.7	SRF-type transcription factor (DNA-binding and dimerisation domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008968114.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008965629.1	0.977	E1A binding protein p300
2	9597.XP_003818965.1	0.972	Mitogen-activated protein kinase 14
3	9597.XP_008974225.1	0.972	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events
4	9597.XP_008972767.1	0.965	Myocyte enhancer factor 2D
5	9597.XP_008963889.1	0.941	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events
6	9597.XP_003822828.1	0.933	Myocyte enhancer factor 2C
7	9597.XP_008949351.1	0.927	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events
8	9597.XP_008961655.1	0.924	Mitogen-activated protein kinase 11
9	9597.XP_003814051.1	0.904	Homeobox protein Nkx-2.5 isoform X1
10	9597.XP_008966263.1	0.899	CREB binding protein
11	9597.XP_008976958.1	0.897	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events
12	9597.XP_003818264.1	0.895	Induces fibroblasts to differentiate into myoblasts. Acts as a transcriptional activator that promotes transcription of muscle- specific target genes and plays a role in muscle differentiation.
13	9597.XP_003811121.2	0.867	Calcineurin binding protein 1
14	9597.XP_008950965.1	0.856	Nuclear factor of activated T-cells 1
15	9597.XP_008957606.1	0.847	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
16	9597.XP_003823047.2	0.838	Myogenin
17	9597.XP_003815319.1	0.830	Nuclear factor of activated T-cells 2
18	9597.XP_003811709.1	0.816	Myogenic factor 6
19	9597.XP_003811708.1	0.814	Induces fibroblasts to differentiate into myoblasts. Acts as a transcriptional activator that promotes transcription of muscle- specific target genes and plays a role in muscle differentiation.
20	9597.XP_003818960.1	0.805	Mitogen-activated protein kinase 13 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0005515	0.998	protein binding
GO:0003700	0.979	DNA-binding transcription factor activity
GO:0000981	0.970	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0019899	0.900	enzyme binding
GO:0001216	0.862	DNA-binding transcription activator activity
GO:0000977	0.861	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0008134	0.839	transcription factor binding
GO:0001228	0.815	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0140297	0.796	DNA-binding transcription factor binding
GO:0000987	0.741	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.694	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0061629	0.673	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0042826	0.613	histone deacetylase binding
GO:0046983	0.607	protein dimerization activity
GO:0003682	0.570	chromatin binding
GO:0046982	0.554	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0010604	0.987	positive regulation of macromolecule metabolic process
GO:0009987	0.986	cellular process
GO:0031325	0.985	positive regulation of cellular metabolic process
GO:0006357	0.985	regulation of transcription by RNA polymerase II
GO:0045893	0.982	positive regulation of DNA-templated transcription
GO:0032501	0.979	multicellular organismal process
GO:0007507	0.972	heart development
GO:0045944	0.958	positive regulation of transcription by RNA polymerase II
GO:0048869	0.639	cellular developmental process
GO:0050896	0.625	response to stimulus
GO:0030154	0.562	cell differentiation
GO:0061061	0.555	muscle structure development
GO:0071840	0.532	cellular component organization or biogenesis
GO:0016043	0.522	cellular component organization
GO:0048468	0.481	cell development
GO:0009653	0.460	anatomical structure morphogenesis
GO:0051716	0.449	cellular response to stimulus
GO:0022607	0.432	cellular component assembly
GO:0030029	0.388	actin filament-based process
GO:0042692	0.387	muscle cell differentiation
GO:0006996	0.384	organelle organization
GO:0051146	0.377	striated muscle cell differentiation
GO:0140694	0.374	non-membrane-bounded organelle assembly
GO:0032989	0.370	cellular component morphogenesis
GO:0031032	0.368	actomyosin structure organization
GO:0055001	0.367	muscle cell development
GO:0030239	0.363	myofibril assembly
GO:0042221	0.342	response to chemical
GO:0008152	0.332	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.997	cytoplasm
GO:0005829	0.993	cytosol
GO:0005667	0.337	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]