StarFunc result for job id Q02153

User Input

>input (619 residues)
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEETKQDDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54865	0.436	0.436	3.268E-103	620	0.989	0.987	O54865.pdb.gz	GCYB1_MOUSE Guanylate cyclase soluble subunit beta-1 OS=Mus musculus OX=10090 GN=Gucy1b1 PE=1 SV=1
2	PDB:6jt0B	0.418	0.445	7.581E-88	576	0.929	0.998	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
3	AFDB:Q9VA09	0.600	0.477	2.477E-79	787	0.598	0.470	Q9VA09.pdb.gz	Q9VA09_DROME guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=Gycbeta100B PE=1 SV=1
4	AFDB:O02298	0.642	0.586	3.685E-55	688	0.347	0.312	O02298.pdb.gz	GCY35_CAEEL Soluble guanylate cyclase gcy-35 OS=Caenorhabditis elegans OX=6239 GN=gcy-35 PE=1 SV=3
5	AFDB:Q6DNF4	0.623	0.578	3.881E-55	675	0.349	0.320	Q6DNF4.pdb.gz	GCY36_CAEEL Soluble guanylate cyclase gcy-36 OS=Caenorhabditis elegans OX=6239 GN=gcy-36 PE=1 SV=1
6	AFDB:Q8INF0	0.616	0.373	1.420E-54	1097	0.351	0.198	Q8INF0.pdb.gz	GCY8E_DROME Soluble guanylate cyclase 88E OS=Drosophila melanogaster OX=7227 GN=Gyc88E PE=1 SV=4
7	AFDB:P92006	0.602	0.549	3.429E-54	686	0.342	0.309	P92006.pdb.gz	GCY34_CAEEL Soluble guanylate cyclase gcy-34 OS=Caenorhabditis elegans OX=6239 GN=gcy-34 PE=2 SV=1
8	AFDB:Q86C56	0.483	0.439	1.052E-52	702	0.315	0.278	Q86C56.pdb.gz	GCY31_CAEEL Soluble guanylate cyclase gcy-31 OS=Caenorhabditis elegans OX=6239 GN=gcy-31 PE=2 SV=2
9	AFDB:P22717	0.573	0.523	2.024E-51	682	0.352	0.320	P22717.pdb.gz	GCYB2_RAT Guanylate cyclase soluble subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gucy1b2 PE=2 SV=1
10	AFDB:P33402	0.539	0.465	5.596E-50	732	0.342	0.290	P33402.pdb.gz	GCYA2_HUMAN Guanylate cyclase soluble subunit alpha-2 OS=Homo sapiens OX=9606 GN=GUCY1A2 PE=1 SV=1
11	AFDB:H2L2D1	0.471	0.333	2.047E-49	947	0.278	0.182	H2L2D1.pdb.gz	H2L2D1_CAEEL guanylate cyclase OS=Caenorhabditis elegans OX=6239 GN=gcy-33 PE=1 SV=1
12	PDB:6jt0A	0.366	0.415	6.391E-41	542	0.312	0.356	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
13	PDB:7d9tA	0.337	0.404	1.011E-37	512	0.299	0.361	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
14	PDB:7d9rA	0.509	0.609	2.392E-36	502	0.304	0.375	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
15	PDB:7yziA	0.348	0.549	8.401E-16	378	0.124	0.204	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
16	PDB:1y11A	0.245	0.399	1.037E-10	364	0.078	0.132	1y11A.pdb.gz
17	PDB:3breB	0.201	0.338	2.412E-3	328	0.055	0.104	3breB.pdb.gz	Phosphorylation-independent regulation of the diguanylate cyclase WspR.
18	PDB:1wc8A	0.169	0.521	2.818E-3	163	0.037	0.141	1wc8A.pdb.gz
19	PDB:4h54A	0.174	0.365	4.267E-3	274	0.048	0.109	4h54A.pdb.gz	Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
20	PDB:7b6dG	0.157	0.456	5.530E-3	169	0.039	0.142	7b6dG.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54865	0.0	1270	620	0.989	0.987	GCYB1_MOUSE Guanylate cyclase soluble subunit beta-1 OS=Mus musculus OX=10090 GN=Gucy1b1 PE=1 SV=1
2	P16068	0.0	1274	619	0.990	0.990	GCYB1_BOVIN Guanylate cyclase soluble subunit beta-1 OS=Bos taurus OX=9913 GN=GUCY1B1 PE=1 SV=1
3	P20595	0.0	1271	619	0.989	0.989	GCYB1_RAT Guanylate cyclase soluble subunit beta-1 OS=Rattus norvegicus OX=10116 GN=Gucy1b1 PE=1 SV=2
4	Q02153	0.0	1283	619	1.000	1.000	GCYB1_HUMAN Guanylate cyclase soluble subunit beta-1 OS=Homo sapiens OX=9606 GN=GUCY1B1 PE=1 SV=1
5	Q24086	0.0	535	758	0.422	0.344	Q24086_DROME guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=Gycbeta100B PE=2 SV=1
6	Q9VA09	0.0	536	787	0.422	0.332	Q9VA09_DROME guanylate cyclase OS=Drosophila melanogaster OX=7227 GN=Gycbeta100B PE=1 SV=1
7	Q6DNF4	2.17e-117	366	675	0.355	0.326	GCY36_CAEEL Soluble guanylate cyclase gcy-36 OS=Caenorhabditis elegans OX=6239 GN=gcy-36 PE=1 SV=1
8	P22717	1.05e-114	359	682	0.362	0.328	GCYB2_RAT Guanylate cyclase soluble subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gucy1b2 PE=2 SV=1
9	O02298	2.15e-114	358	688	0.349	0.314	GCY35_CAEEL Soluble guanylate cyclase gcy-35 OS=Caenorhabditis elegans OX=6239 GN=gcy-35 PE=1 SV=3
10	P92006	2.27e-110	348	686	0.362	0.327	GCY34_CAEEL Soluble guanylate cyclase gcy-34 OS=Caenorhabditis elegans OX=6239 GN=gcy-34 PE=2 SV=1
11	F8VQK3	3.17e-108	344	730	0.331	0.281	F8VQK3_MOUSE guanylate cyclase OS=Mus musculus OX=10090 GN=Gucy1a2 PE=1 SV=1
12	Q8INF0	3.22e-108	352	1097	0.357	0.201	GCY8E_DROME Soluble guanylate cyclase 88E OS=Drosophila melanogaster OX=7227 GN=Gyc88E PE=1 SV=4
13	Q9WVI4	1.28e-106	340	730	0.328	0.278	GCYA2_RAT Guanylate cyclase soluble subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Gucy1a2 PE=1 SV=2
14	P33402	1.66e-106	339	732	0.334	0.283	GCYA2_HUMAN Guanylate cyclase soluble subunit alpha-2 OS=Homo sapiens OX=9606 GN=GUCY1A2 PE=1 SV=1
15	Q02108	6.90e-92	300	690	0.312	0.280	GCYA1_HUMAN Guanylate cyclase soluble subunit alpha-1 OS=Homo sapiens OX=9606 GN=GUCY1A1 PE=1 SV=2
16	P19686	2.36e-91	298	690	0.325	0.291	GCYA1_RAT Guanylate cyclase soluble subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Gucy1a1 PE=1 SV=1
17	O75343	7.62e-89	290	617	0.265	0.266	GCYB2_HUMAN Guanylate cyclase soluble subunit beta-2 OS=Homo sapiens OX=9606 GN=GUCY1B2 PE=5 SV=2
18	Q9ERL9	8.18e-89	291	691	0.302	0.271	GCYA1_MOUSE Guanylate cyclase soluble subunit alpha-1 OS=Mus musculus OX=10090 GN=Gucy1a1 PE=1 SV=2
19	Q86C56	6.25e-84	279	702	0.334	0.295	GCY31_CAEEL Soluble guanylate cyclase gcy-31 OS=Caenorhabditis elegans OX=6239 GN=gcy-31 PE=2 SV=2
20	E7EZW5	2.58e-80	269	679	0.292	0.267	E7EZW5_DANRE guanylate cyclase OS=Danio rerio OX=7955 GN=sgc1a1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00211 Guanylate_cyc	8e-64	226.2	Adenylate and Guanylate cyclase catalytic domain
2	PF07700 HNOB	1.6e-51	185.8	Haem-NO-binding
3	PF07701 HNOBA	1.6e-51	186.4	Heme NO binding associated

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007597

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007562	0.998	Guanylate cyclase 1, soluble, alpha 3
2	61853.ENSNLEP00000011066	0.969	Phosphodiesterase 5A, cGMP-specific
3	61853.ENSNLEP00000015630	0.962	Phosphodiesterase 6C, cGMP-specific, cone, alpha prime
4	61853.ENSNLEP00000001026	0.961	Phosphodiesterase 6B, cGMP-specific, rod, beta
5	61853.ENSNLEP00000012436	0.961	Phosphodiesterase 6A, cGMP-specific, rod, alpha
6	61853.ENSNLEP00000007359	0.958	Phosphodiesterase 11A
7	61853.ENSNLEP00000017800	0.923	Phosphodiesterase 9A
8	61853.ENSNLEP00000010411	0.910	Protein kinase, cGMP-dependent, type II
9	61853.ENSNLEP00000016838	0.908	Pyruvate kinase, muscle
10	61853.ENSNLEP00000005991	0.900	Nudix hydrolase 2
11	61853.ENSNLEP00000008794	0.887	Guanylate cyclase 1, soluble, alpha 2
12	61853.ENSNLEP00000014604	0.877	Protein kinase, cGMP-dependent, type I
13	61853.ENSNLEP00000000357	0.823	Nitric oxide synthase
14	61853.ENSNLEP00000020884	0.811	Phosphodiesterase 2A, cGMP-stimulated
15	61853.ENSNLEP00000015486	0.807	GTP cyclohydrolase 1
16	61853.ENSNLEP00000014036	0.804	Phosphodiesterase 10A
17	61853.ENSNLEP00000000621	0.800	Uncharacterized protein
18	61853.ENSNLEP00000018526	0.767	Phosphodiesterase 1C, calmodulin-dependent 70kDa
19	61853.ENSNLEP00000007727	0.753	Phosphodiesterase 1A, calmodulin-dependent
20	61853.ENSNLEP00000017234	0.737	Phosphodiesterase 6D, cGMP-specific, rod, delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004383	1.000	guanylate cyclase activity
GO:1901363	0.996	heterocyclic compound binding
GO:0097159	0.996	organic cyclic compound binding
GO:0005515	0.995	protein binding
GO:0046906	0.992	tetrapyrrole binding
GO:0020037	0.781	heme binding
GO:0036094	0.745	small molecule binding
GO:0043167	0.472	ion binding
GO:0060089	0.374	molecular transducer activity
GO:0038023	0.355	signaling receptor activity
GO:0004016	0.311	adenylate cyclase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0019935	0.977	cyclic-nucleotide-mediated signaling
GO:0071704	0.970	organic substance metabolic process
GO:0006796	0.968	phosphate-containing compound metabolic process
GO:0006807	0.967	nitrogen compound metabolic process
GO:0044238	0.954	primary metabolic process
GO:0034641	0.954	cellular nitrogen compound metabolic process
GO:1901564	0.951	organonitrogen compound metabolic process
GO:0044281	0.944	small molecule metabolic process
GO:0019637	0.943	organophosphate metabolic process
GO:1901360	0.938	organic cyclic compound metabolic process
GO:0046483	0.937	heterocycle metabolic process
GO:0019693	0.930	ribose phosphate metabolic process
GO:0072521	0.926	purine-containing compound metabolic process
GO:0009117	0.925	nucleotide metabolic process
GO:0009259	0.897	ribonucleotide metabolic process
GO:0009187	0.886	cyclic nucleotide metabolic process
GO:0006163	0.885	purine nucleotide metabolic process
GO:1901293	0.852	nucleoside phosphate biosynthetic process
GO:0009165	0.837	nucleotide biosynthetic process
GO:0009190	0.826	cyclic nucleotide biosynthetic process
GO:0052652	0.824	cyclic purine nucleotide metabolic process
GO:0046390	0.811	ribose phosphate biosynthetic process
GO:0009150	0.810	purine ribonucleotide metabolic process
GO:0009260	0.781	ribonucleotide biosynthetic process
GO:0072522	0.676	purine-containing compound biosynthetic process
GO:0006164	0.653	purine nucleotide biosynthetic process
GO:0009152	0.553	purine ribonucleotide biosynthetic process
GO:0032501	0.487	multicellular organismal process
GO:0019934	0.337	cGMP-mediated signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.997	protein-containing complex
GO:1902494	0.980	catalytic complex
GO:0016020	0.840	membrane
GO:0071944	0.703	cell periphery
GO:0043229	0.534	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13665	1.000	GTP = 3',5'-cyclic GMP + diphosphate
EC:4.6.1.2	1.000	guanylate cyclase.
RHEA:15389	0.311	ATP = 3',5'-cyclic AMP + diphosphate
EC:4.6.1.1	0.311	adenylate cyclase.

[back to server]