StarFunc result for job id Q02156

User Input

>input (737 residues)
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B8A467	0.578	0.578	0.000	738	0.866	0.864	B8A467.pdb.gz	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
2	AFDB:L7RTI5	0.574	0.574	0.000	737	1.000	1.000	L7RTI5.pdb.gz	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
3	AFDB:P23298	0.532	0.572	1.633E-99	683	0.604	0.652	P23298.pdb.gz	KPCL_MOUSE Protein kinase C eta type OS=Mus musculus OX=10090 GN=Prkch PE=1 SV=2
4	AFDB:P13678	0.554	0.553	6.323E-97	739	0.585	0.583	P13678.pdb.gz	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
5	AFDB:H9G2Y7	0.500	0.484	1.973E-96	763	0.581	0.561	H9G2Y7.pdb.gz	H9G2Y7_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=1
6	AFDB:A0A024R328	0.473	0.514	2.310E-74	676	0.398	0.433	A0A024R328.pdb.gz
7	AFDB:Q02111	0.544	0.564	1.308E-73	707	0.411	0.429	Q02111.pdb.gz	KPCT_MOUSE Protein kinase C theta type OS=Mus musculus OX=10090 GN=Prkcq PE=1 SV=1
8	AFDB:F1R506	0.524	0.539	1.715E-73	713	0.408	0.422	F1R506.pdb.gz	F1R506_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=si:ch211-239o15.1 PE=3 SV=3
9	AFDB:P09215	0.525	0.567	5.067E-73	673	0.404	0.443	P09215.pdb.gz	KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus OX=10116 GN=Prkcd PE=1 SV=1
10	AFDB:Q7ZUC5	0.554	0.592	9.971E-72	684	0.385	0.415	Q7ZUC5.pdb.gz	Q7ZUC5_DANRE Protein kinase C delta type OS=Danio rerio OX=7955 GN=prkcd PE=1 SV=1
11	PDB:3pfqA	0.429	0.601	1.084E-41	523	0.320	0.451	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6byrA	0.413	0.741	5.645E-30	405	0.174	0.316	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
13	PDB:5x3fB	0.375	0.768	1.538E-28	349	0.164	0.347	5x3fB.pdb.gz
14	PDB:6s9wA	0.352	0.613	4.796E-28	411	0.204	0.365	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
15	PDB:6hhgA	0.343	0.637	2.866E-27	386	0.194	0.370	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
16	PDB:3c4wB	0.369	0.518	3.194E-27	519	0.157	0.224	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
17	PDB:4mk0A	0.386	0.448	3.194E-27	631	0.134	0.157	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:3pvuA	0.381	0.458	5.491E-27	609	0.133	0.161	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
19	PDB:4yhjA	0.394	0.570	7.199E-27	501	0.159	0.234	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
20	PDB:6pjxA	0.388	0.522	1.172E-26	543	0.156	0.212	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QIY5	576	670	0.412	0.454	A0A2R8QIY5_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=im:7139045 PE=3 SV=1
2	B8A467	1318	738	0.866	0.864	B8A467_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=prkceb PE=3 SV=1
3	F1R506	595	713	0.419	0.433	F1R506_DANRE Protein kinase C OS=Danio rerio OX=7955 GN=si:ch211-239o15.1 PE=3 SV=3
4	H9G2Y7	863	763	0.575	0.556	H9G2Y7_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-1 PE=1 SV=1
5	L7RSM7	592	672	0.418	0.458	L7RSM7_HUMAN Protein kinase C OS=Homo sapiens OX=9606 GN=PRKCA PE=3 SV=1
6	L7RTI5	1540	737	1.000	1.000	L7RTI5_HUMAN Protein kinase C epsilon type OS=Homo sapiens OX=9606 GN=PRKCE PE=3 SV=1
7	P04409	589	672	0.417	0.457	KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus OX=9913 GN=PRKCA PE=1 SV=3
8	P05130	566	679	0.412	0.448	KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster OX=7227 GN=Pkc53E PE=2 SV=2
9	P05696	593	672	0.419	0.460	KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus OX=10116 GN=Prkca PE=1 SV=3
10	P05771	592	671	0.427	0.469	KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens OX=9606 GN=PRKCB PE=1 SV=4
11	P09215	579	673	0.399	0.437	KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus OX=10116 GN=Prkcd PE=1 SV=1
12	P09216	1517	737	0.981	0.981	KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus OX=10116 GN=Prkce PE=1 SV=1
13	P13678	870	739	0.585	0.583	KPC3_DROME Protein kinase C OS=Drosophila melanogaster OX=7227 GN=Pkc98E PE=2 SV=2
14	P16054	1518	737	0.980	0.980	KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus OX=10090 GN=Prkce PE=1 SV=1
15	P17252	592	672	0.418	0.458	KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens OX=9606 GN=PRKCA PE=1 SV=4
16	P20444	585	672	0.417	0.457	KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus OX=10090 GN=Prkca PE=1 SV=3
17	P23298	906	683	0.607	0.654	KPCL_MOUSE Protein kinase C eta type OS=Mus musculus OX=10090 GN=Prkch PE=1 SV=2
18	P24723	912	683	0.612	0.660	KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens OX=9606 GN=PRKCH PE=1 SV=4
19	P28867	578	674	0.399	0.436	KPCD_MOUSE Protein kinase C delta type OS=Mus musculus OX=10090 GN=Prkcd PE=1 SV=3
20	P34722	551	704	0.403	0.422	KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans OX=6239 GN=tpa-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.15	22.7	ABC1 atypical kinase-like domain
2	PF00130 C1_1	3.9e-29	111.6	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF03107 C1_2	7.7e+02	11.8	C1 domain
4	PF00168 C2	2.6e-09	48.6	C2 domain
5	PF13095 FTA2	28	15.9	Kinetochore Sim4 complex subunit FTA2
6	PF06293 Kdo	1.9e+02	12.8	Lipopolysaccharide kinase (Kdo/WaaP) family
7	PF14531 Kinase-like	56	14.5	Kinase-like
8	PF00069 Pkinase	6.4e-62	220.9	Protein kinase domain
9	PF00433 Pkinase_C	3.7e-05	35.6	Protein kinase C terminal domain
10	PF07714 PK_Tyr_Ser-Thr	5.7e-34	129.1	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020530

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007753	0.949	Protein phosphatase 1, catalytic subunit, alpha isozyme
2	61853.ENSNLEP00000010109	0.943	HRas proto-oncogene, GTPase
3	61853.ENSNLEP00000006371	0.939	KRAS proto-oncogene, GTPase
4	61853.ENSNLEP00000003935	0.934	Uncharacterized protein
5	61853.ENSNLEP00000008796	0.917	Protein kinase C delta type
6	61853.ENSNLEP00000003868	0.909	Protein phosphatase 1, catalytic subunit, gamma isozyme
7	61853.ENSNLEP00000018622	0.902	Protein phosphatase 1, catalytic subunit, beta isozyme
8	61853.ENSNLEP00000021483	0.892	Uncharacterized protein
9	61853.ENSNLEP00000018944	0.887	Mitogen-activated protein kinase 8
10	61853.ENSNLEP00000011344	0.885	Mitogen-activated protein kinase 10
11	61853.ENSNLEP00000020944	0.881	Transient receptor potential cation channel subfamily V member 1
12	61853.ENSNLEP00000002611	0.879	Mitogen-activated protein kinase 9
13	61853.ENSNLEP00000005755	0.870	Raf-1 proto-oncogene, serine/threonine kinase
14	61853.ENSNLEP00000002843	0.869	Sphingosine kinase 1
15	61853.ENSNLEP00000005507	0.869	Sphingosine kinase 2
16	61853.ENSNLEP00000022231	0.867	Insulin receptor substrate 4
17	61853.ENSNLEP00000000536	0.863	Moesin
18	61853.ENSNLEP00000008839	0.863	Radixin
19	61853.ENSNLEP00000013329	0.863	Ezrin
20	61853.ENSNLEP00000013944	0.861	Transient receptor potential cation channel, subfamily A, member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004697	1.000	protein kinase C activity
GO:0019899	0.810	enzyme binding
GO:0098772	0.329	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009987	0.992	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0006793	0.977	phosphorus metabolic process
GO:0051716	0.973	cellular response to stimulus
GO:0007154	0.966	cell communication
GO:0071704	0.959	organic substance metabolic process
GO:0023052	0.949	signaling
GO:0048518	0.922	positive regulation of biological process
GO:0007165	0.914	signal transduction
GO:0043412	0.908	macromolecule modification
GO:0019538	0.907	protein metabolic process
GO:0048522	0.900	positive regulation of cellular process
GO:0006796	0.895	phosphate-containing compound metabolic process
GO:0016310	0.894	phosphorylation
GO:0036211	0.893	protein modification process
GO:0032879	0.819	regulation of localization
GO:0006468	0.809	protein phosphorylation
GO:0051049	0.775	regulation of transport
GO:0048519	0.649	negative regulation of biological process
GO:0019222	0.607	regulation of metabolic process
GO:0023051	0.537	regulation of signaling
GO:0048523	0.528	negative regulation of cellular process
GO:0010646	0.519	regulation of cell communication
GO:0042221	0.510	response to chemical
GO:0048583	0.500	regulation of response to stimulus
GO:0032501	0.472	multicellular organismal process
GO:0060255	0.462	regulation of macromolecule metabolic process
GO:0080090	0.455	regulation of primary metabolic process
GO:0031323	0.455	regulation of cellular metabolic process
GO:0065009	0.447	regulation of molecular function
GO:0051171	0.440	regulation of nitrogen compound metabolic process
GO:0070887	0.437	cellular response to chemical stimulus
GO:0009966	0.422	regulation of signal transduction
GO:0010033	0.392	response to organic substance
GO:0032502	0.373	developmental process
GO:0009893	0.353	positive regulation of metabolic process
GO:0048856	0.348	anatomical structure development
GO:0010468	0.340	regulation of gene expression
GO:0051179	0.332	localization
GO:0035556	0.330	intracellular signal transduction
GO:0048584	0.329	positive regulation of response to stimulus
GO:0034762	0.321	regulation of transmembrane transport
GO:0071840	0.315	cellular component organization or biogenesis
GO:0007166	0.314	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.999	cell periphery
GO:0005829	0.999	cytosol
GO:0043226	0.998	organelle
GO:0005886	0.988	plasma membrane
GO:0043229	0.987	intracellular organelle
GO:0043227	0.970	membrane-bounded organelle
GO:0043231	0.924	intracellular membrane-bounded organelle
GO:0012505	0.678	endomembrane system
GO:0043232	0.452	intracellular non-membrane-bounded organelle
GO:0005634	0.337	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.13	1.000	protein kinase C.

[back to server]