StarFunc result for job id Q02221

User Input

>input (97 residues)
MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFR
PYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02221	1.000	1.000	1.483E-18	97	1.000	1.000	Q02221.pdb.gz	CX6A2_HUMAN Cytochrome c oxidase subunit 6A2, mitochondrial OS=Homo sapiens OX=9606 GN=COX6A2 PE=1 SV=2
2	AFDB:P43023	0.857	0.857	2.001E-15	97	0.784	0.784	P43023.pdb.gz	CX6A2_MOUSE Cytochrome c oxidase subunit 6A2, mitochondrial OS=Mus musculus OX=10090 GN=Cox6a2 PE=1 SV=2
3	AFDB:P07471	0.911	0.911	6.065E-15	97	0.804	0.804	P07471.pdb.gz	CX6A2_BOVIN Cytochrome c oxidase subunit 6A2, mitochondrial OS=Bos taurus OX=9913 GN=COX6A2 PE=1 SV=2
4	PDB:2y69G	0.782	0.897	4.192E-11	84	0.701	0.810	2y69G.pdb.gz	A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
5	AFDB:H6SG15	0.721	0.644	1.851E-10	109	0.598	0.532	H6SG15.pdb.gz	H6SG15_HUMAN Cytochrome c oxidase subunit OS=Homo sapiens OX=9606 GN=COX6A1 PE=2 SV=1
6	AFDB:P43024	0.736	0.647	6.446E-10	111	0.567	0.495	P43024.pdb.gz	CX6A1_MOUSE Cytochrome c oxidase subunit 6A1, mitochondrial OS=Mus musculus OX=10090 GN=Cox6a1 PE=1 SV=2
7	AFDB:Q9W1N3	0.713	0.638	9.471E-8	109	0.423	0.376	Q9W1N3.pdb.gz	Q9W1N3_DROME Levy, isoform A OS=Drosophila melanogaster OX=7227 GN=levy PE=1 SV=1
8	AFDB:Q20779	0.550	0.436	2.740E-4	128	0.330	0.250	Q20779.pdb.gz	COX6A_CAEEL Cytochrome c oxidase subunit 6A, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=cox-6A PE=3 SV=1
9	AFDB:P32799	0.545	0.414	9.391E-3	129	0.289	0.217	P32799.pdb.gz	COX13_YEAST Cytochrome c oxidase subunit 13, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX13 PE=1 SV=1
10	AFDB:O74471	0.453	0.354	1.079E-2	130	0.309	0.231	O74471.pdb.gz	COX13_SCHPO Cytochrome c oxidase subunit 13, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox13 PE=1 SV=1
11	AFDB:Q5ALV9	0.471	0.356	3.270E-2	134	0.268	0.194	Q5ALV9.pdb.gz	Q5ALV9_CANAL Cytochrome c oxidase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX13 PE=3 SV=1
12	PDB:6zdbA	0.260	0.207	7.574	129	0.258	0.194	6zdbA.pdb.gz
13	PDB:4v6wCG	0.144	0.063	8.117	241	0.103	0.041	4v6wCG.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:6lqsB1	0.262	0.032	8.700	806	0.062	0.007	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q02221	7.72e-67	197	97	1.000	1.000	CX6A2_HUMAN Cytochrome c oxidase subunit 6A2, mitochondrial OS=Homo sapiens OX=9606 GN=COX6A2 PE=1 SV=2
2	P43023	1.39e-52	161	97	0.784	0.784	CX6A2_MOUSE Cytochrome c oxidase subunit 6A2, mitochondrial OS=Mus musculus OX=10090 GN=Cox6a2 PE=1 SV=2
3	P07471	6.97e-52	159	97	0.804	0.804	CX6A2_BOVIN Cytochrome c oxidase subunit 6A2, mitochondrial OS=Bos taurus OX=9913 GN=COX6A2 PE=1 SV=2
4	P10817	4.96e-50	154	94	0.742	0.766	CX6A2_RAT Cytochrome c oxidase subunit 6A2, mitochondrial (Fragment) OS=Rattus norvegicus OX=10116 GN=Cox6a2 PE=1 SV=3
5	H6SG15	4.91e-32	109	109	0.588	0.523	H6SG15_HUMAN Cytochrome c oxidase subunit OS=Homo sapiens OX=9606 GN=COX6A1 PE=2 SV=1
6	P12074	4.91e-32	109	109	0.588	0.523	CX6A1_HUMAN Cytochrome c oxidase subunit 6A1, mitochondrial OS=Homo sapiens OX=9606 GN=COX6A1 PE=1 SV=4
7	P43024	1.16e-29	103	111	0.577	0.505	CX6A1_MOUSE Cytochrome c oxidase subunit 6A1, mitochondrial OS=Mus musculus OX=10090 GN=Cox6a1 PE=1 SV=2
8	Q9W1N3	2.84e-24	90.1	109	0.423	0.376	Q9W1N3_DROME Levy, isoform A OS=Drosophila melanogaster OX=7227 GN=levy PE=1 SV=1
9	Q20779	1.12e-12	61.2	128	0.299	0.227	COX6A_CAEEL Cytochrome c oxidase subunit 6A, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=cox-6A PE=3 SV=1
10	H0YIV9	1.08e-11	59.3	168	0.330	0.190	H0YIV9_HUMAN Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
11	P32799	1.16e-10	55.8	129	0.309	0.233	COX13_YEAST Cytochrome c oxidase subunit 13, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX13 PE=1 SV=1
12	Q5ALV9	8.14e-09	51.2	134	0.299	0.216	Q5ALV9_CANAL Cytochrome c oxidase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX13 PE=3 SV=1
13	O74471	7.53e-08	48.5	130	0.289	0.215	COX13_SCHPO Cytochrome c oxidase subunit 13, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox13 PE=1 SV=1
14	Q9T070	0.014	34.3	102	0.268	0.255	COX6A_ARATH Cytochrome c oxidase subunit 6a, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=COX6A PE=3 SV=1
15	Q9VQ36	0.60	30.8	951	0.247	0.025	FRITZ_DROME WD repeat-containing and planar cell polarity effector protein fritz OS=Drosophila melanogaster OX=7227 GN=frtz PE=1 SV=1
16	D3ZKM3	0.88	29.3	77	0.206	0.260	GP15L_RAT Protein GPR15LG OS=Rattus norvegicus OX=10116 GN=Gpr15lg PE=3 SV=2
17	P35084	2.6	28.9	1727	0.206	0.012	RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum OX=44689 GN=polr2a PE=2 SV=2
18	Q64104	5.4	28.1	385	0.134	0.034	NR2E1_MOUSE Nuclear receptor subfamily 2 group E member 1 OS=Mus musculus OX=10090 GN=Nr2e1 PE=1 SV=1
19	Q9Y466	5.5	28.1	385	0.134	0.034	NR2E1_HUMAN Nuclear receptor subfamily 2 group E member 1 OS=Homo sapiens OX=9606 GN=NR2E1 PE=1 SV=1
20	Q9NP60	8.1	27.7	686	0.186	0.026	IRPL2_HUMAN X-linked interleukin-1 receptor accessory protein-like 2 OS=Homo sapiens OX=9606 GN=IL1RAPL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02046 COX6A	3.1e-10	51.9	Cytochrome c oxidase subunit VIa

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287490

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000317780	0.999	Cytochrome c oxidase subunit 5A, mitochondrial
2	9606.ENSP00000428895	0.998	Cytochrome c oxidase subunit 6C
3	9606.ENSP00000246554	0.996	Cytochrome c oxidase subunit 6B1
4	9606.ENSP00000258424	0.990	Cytochrome c oxidase subunit 5B, mitochondrial
5	9606.ENSP00000332887	0.990	Cytochrome b-c1 complex subunit 9
6	9606.ENSP00000367939	0.990	Cytochrome b-c1 complex subunit 8
7	9606.ENSP00000365243	0.988	Cytochrome c oxidase subunit 4 isoform 2, mitochondrial
8	9606.ENSP00000457513	0.988	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
9	9606.ENSP00000215565	0.986	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
10	9606.ENSP00000268668	0.986	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
11	9606.ENSP00000417142	0.985	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
12	9606.ENSP00000467266	0.985	Cytochrome c oxidase subunit 6B2
13	9606.ENSP00000274137	0.983	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
14	9606.ENSP00000268379	0.982	Cytochrome b-c1 complex subunit 2, mitochondrial
15	9606.ENSP00000458770	0.980	Acyl carrier protein, mitochondrial
16	9606.ENSP00000215375	0.975	ATP synthase subunit delta, mitochondrial
17	9606.ENSP00000276689	0.975	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
18	9606.ENSP00000425759	0.971	Cytochrome c oxidase subunit 7C, mitochondrial
19	9606.ENSP00000358737	0.970	ATP synthase F(0) complex subunit B1, mitochondrial
20	9606.ENSP00000430494	0.969	Cytochrome b-c1 complex subunit 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005488	0.926	binding
GO:0005515	0.881	protein binding
GO:0003824	0.772	catalytic activity
GO:0022857	0.636	transmembrane transporter activity
GO:0016491	0.568	oxidoreductase activity
GO:0098772	0.561	molecular function regulator activity
GO:0030234	0.486	enzyme regulator activity
GO:0015399	0.399	primary active transmembrane transporter activity
GO:0009055	0.363	electron transfer activity
GO:0015453	0.361	oxidoreduction-driven active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0006091	0.962	generation of precursor metabolites and energy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.995	mitochondrion
GO:0032991	0.991	protein-containing complex
GO:0016020	0.985	membrane
GO:0031090	0.928	organelle membrane
GO:0005743	0.917	mitochondrial inner membrane
GO:0098803	0.899	respiratory chain complex
GO:1902494	0.897	catalytic complex
GO:0098800	0.868	inner mitochondrial membrane protein complex
GO:0005746	0.731	mitochondrial respirasome
GO:0070069	0.727	cytochrome complex
GO:0045277	0.647	respiratory chain complex IV

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.568	Oxidoreductases.
EC:7.-.-.-	0.399	Translocases.

[back to server]