StarFunc result for job id Q02224

User Input

>input (1400 residues)
MAEEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFHGNETTK
NVYEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKF
PDREFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALK
WITKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSE
RAAQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNA
KTRIICTITPVSFDETLTALQFASTAKYMKNTPYVNEVSTDEALLKRYRKEIMDLKKQLE
EVSLETRAQAMEKDQLAQLLEEKDLLQKVQNEKIENLTRMLVTSSSLTLQQELKAKRKRR
VTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLS
EIEWNPATKLLNQENIESELNSLRADYDNLVLDYEQLRTEKEEMELKLKEKNDLDEFEAL
ERKTKKDQEMQLIHEISNLKNLVKHAEVYNQDLENELSSKVELLREKEDQIKKLQEYIDS
QKLENIKMDLSYSLESIEDPKQMKQTLFDAETVALDAKRESAFLRSENLELKEKMKELAT
TYKQMENDIQLYQSQLEAKKKMQVDLEKELQSAFNEITKLTSLIDGKVPKDLLCNLELEG
KITDLQKELNKEVEENEALREEVILLSELKSLPSEVERLRKEIQDKSEELHIITSEKDKL
FSEVVHKESRVQGLLEEIGKTKDDLATTQSNYKSTDQEFQNFKTLHMDFEQKYKMVLEEN
ERMNQEIVNLSKEAQKFDSSLGALKTELSYKTQELQEKTREVQERLNEMEQLKEQLENRD
STLQTVEREKTLITEKLQQTLEEVKTLTQEKDDLKQLQESLQIERDQLKSDIHDTVNMNI
DTQEQLRNALESLKQHQETINTLKSKISEEVSRNLHMEENTGETKDEFQQKMVGIDKKQD
LEAKNTQTLTADVKDNEIIEQQRKIFSLIQEKNELQQMLESVIAEKEQLKTDLKENIEMT
IENQEELRLLGDELKKQQEIVAQEKNHAIKKEGELSRTCDRLAEVEEKLKEKSQQLQEKQ
QQLLNVQEEMSEMQKKINEIENLKNELKNKELTLEHMETERLELAQKLNENYEEVKSITK
ERKVLKELQKSFETERDHLRGYIREIEATGLQTKEELKIAHIHLKEHQETIDELRRSVSE
KTAQIINTQDLEKSHTKLQEEIPVLHEEQELLPNVKEVSETQETMNELELLTEQSTTKDS
TTLARIEMERLRLNEKFQESQEEIKSLTKERDNLKTIKEALEVKHDQLKEHIRETLAKIQ
ESQSKQEQSLNMKEKDNETT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6RT24	0.243	0.139	0.000	2474	0.695	0.393	Q6RT24.pdb.gz	CENPE_MOUSE Centromere-associated protein E OS=Mus musculus OX=10090 GN=Cenpe PE=1 SV=1
2	AFDB:Q54NP8	0.240	0.176	5.404E-51	1922	0.266	0.194	Q54NP8.pdb.gz	KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium discoideum OX=44689 GN=kif4 PE=2 SV=1
3	AFDB:Q9VKI0	0.249	0.161	1.809E-48	2189	0.258	0.165	Q9VKI0.pdb.gz	Q9VKI0_DROME CENP-meta, isoform C OS=Drosophila melanogaster OX=7227 GN=cmet PE=1 SV=3
4	AFDB:Q8W5R5	0.252	0.331	5.588E-47	1055	0.170	0.226	Q8W5R5.pdb.gz	KN7D_ARATH Kinesin-like protein KIN-7D, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KIN7D PE=2 SV=1
5	AFDB:Q6S001	0.233	0.468	4.636E-45	685	0.151	0.309	Q6S001.pdb.gz	KIF11_DICDI Kinesin-related protein 11 OS=Dictyostelium discoideum OX=44689 GN=kif11 PE=3 SV=1
6	AFDB:Q8T135	0.234	0.328	2.560E-43	990	0.183	0.259	Q8T135.pdb.gz	KIF5_DICDI Kinesin-related protein 5 OS=Dictyostelium discoideum OX=44689 GN=kif5 PE=1 SV=1
7	AFDB:Q6S002	0.236	0.266	8.190E-43	1238	0.126	0.142	Q6S002.pdb.gz	KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum OX=44689 GN=kif10 PE=3 SV=1
8	AFDB:F4JZ68	0.241	0.316	2.620E-42	1063	0.129	0.170	F4JZ68.pdb.gz	KN7H_ARATH Kinesin-like protein KIN-7H OS=Arabidopsis thaliana OX=3702 GN=KIN7H PE=2 SV=1
9	AFDB:C8V3Q8	0.229	0.356	3.935E-42	889	0.141	0.223	C8V3Q8.pdb.gz	C8V3Q8_EMENI Kinesin-like protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=kipA PE=3 SV=1
10	AFDB:Q54TL0	0.239	0.265	1.188E-41	1255	0.127	0.142	Q54TL0.pdb.gz	KIF7_DICDI Kinesin-related protein 7 OS=Dictyostelium discoideum OX=44689 GN=kif7 PE=2 SV=1
11	PDB:7wrgB	0.217	0.382	1.374E-31	783	0.101	0.180	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgA	0.226	0.385	1.734E-31	812	0.099	0.170	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.192	0.392	6.591E-26	670	0.076	0.158	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:7w85A	0.044	0.114	6.768E-2	435	0.016	0.051	7w85A.pdb.gz
15	PDB:5j6hA	0.036	0.122	1.927E-1	275	0.015	0.076	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
16	PDB:6d7gA	0.044	0.106	2.295E-1	386	0.017	0.062	6d7gA.pdb.gz
17	PDB:1fa9A	0.038	0.046	3.069E-1	834	0.020	0.034	1fa9A.pdb.gz	Activation of human liver glycogen phosphorylase by alteration of the secondary structure and packing of the catalytic core.
18	PDB:7vhpG	0.045	0.168	4.104E-1	299	0.026	0.120	7vhpG.pdb.gz
19	PDB:5ye5A	0.035	0.087	4.886E-1	464	0.012	0.037	5ye5A.pdb.gz
20	PDB:4xmmE	0.034	0.047	6.534E-1	896	0.018	0.028	4xmmE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O42263	0.0	683	2954	0.234	0.111	O42263_XENLA Kinesin-related protein OS=Xenopus laevis OX=8355 GN=XCENP-E PE=1 SV=1
2	Q02224	0.0	2808	2701	1.000	0.518	CENPE_HUMAN Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE PE=1 SV=2
3	Q6RT24	0.0	1864	2474	0.696	0.394	CENPE_MOUSE Centromere-associated protein E OS=Mus musculus OX=10090 GN=Cenpe PE=1 SV=1
4	Q9VKI0	2.99e-94	339	2189	0.229	0.146	Q9VKI0_DROME CENP-meta, isoform C OS=Drosophila melanogaster OX=7227 GN=cmet PE=1 SV=3
5	M9PCX3	3.04e-94	339	2186	0.229	0.146	M9PCX3_DROME CENP-meta, isoform E OS=Drosophila melanogaster OX=7227 GN=cmet PE=1 SV=1
6	Q54NP8	1.70e-93	336	1922	0.122	0.089	KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium discoideum OX=44689 GN=kif4 PE=2 SV=1
7	Q9NCG0	2.71e-92	333	2244	0.229	0.143	Q9NCG0_DROME Kinesin-like kinetochore motor protein CENP-meta OS=Drosophila melanogaster OX=7227 GN=cmet PE=2 SV=1
8	M9PD87	1.15e-89	324	2134	0.136	0.089	M9PD87_DROME CENP-meta, isoform D OS=Drosophila melanogaster OX=7227 GN=cmet PE=1 SV=1
9	M9PFL9	1.20e-89	324	2132	0.136	0.089	M9PFL9_DROME CENP-meta, isoform F OS=Drosophila melanogaster OX=7227 GN=cmet PE=1 SV=1
10	Q6S001	1.07e-88	305	685	0.126	0.257	KIF11_DICDI Kinesin-related protein 11 OS=Dictyostelium discoideum OX=44689 GN=kif11 PE=3 SV=1
11	Q8W5R5	5.00e-85	303	1055	0.118	0.156	KN7D_ARATH Kinesin-like protein KIN-7D, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KIN7D PE=2 SV=1
12	P46873	7.57e-85	295	699	0.124	0.247	OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans OX=6239 GN=osm-3 PE=1 SV=4
13	A0A0G2JUD6	8.32e-85	295	701	0.122	0.244	A0A0G2JUD6_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=2
14	A0A8I6AL48	1.15e-84	294	684	0.122	0.250	A0A8I6AL48_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
15	A0A8I6GCQ1	1.25e-84	293	674	0.122	0.254	A0A8I6GCQ1_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
16	A0A8I6AP89	2.00e-84	293	686	0.122	0.249	A0A8I6AP89_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=3 SV=1
17	E9QB71	2.08e-84	294	701	0.120	0.240	E9QB71_DANRE Kinesin-like protein OS=Danio rerio OX=7955 GN=fc55h04 PE=1 SV=1
18	Q9Y496	2.37e-84	293	699	0.121	0.243	KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens OX=9606 GN=KIF3A PE=1 SV=4
19	P28741	2.45e-84	293	701	0.122	0.244	KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus OX=10090 GN=Kif3a PE=1 SV=2
20	F1LQZ3	2.74e-84	294	726	0.122	0.236	F1LQZ3_RAT Kinesin-like protein OS=Rattus norvegicus OX=10116 GN=Kif3a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00225 Kinesin	1.6e-108	374.2	Kinesin motor domain
2	PF16796 Microtub_bd	4e-24	96.8	Microtubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265148

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287598	0.999	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
2	9606.ENSP00000261597	0.998	Kinetochore protein NDC80 homolog
3	9606.ENSP00000300093	0.998	Serine/threonine-protein kinase PLK1
4	9606.ENSP00000302530	0.996	Mitotic checkpoint serine/threonine-protein kinase BUB1
5	9606.ENSP00000355922	0.995	Centromere protein F
6	9606.ENSP00000356379	0.994	Abnormal spindle-like microcephaly-associated protein
7	9606.ENSP00000361540	0.994	Cell division cycle protein 20 homolog
8	9606.ENSP00000260731	0.993	Kinesin-like protein KIF11
9	9606.ENSP00000358813	0.993	Dual specificity protein kinase TTK
10	9606.ENSP00000378699	0.991	Cyclin-dependent kinase 1
11	9606.ENSP00000313950	0.989	Aurora kinase B
12	9606.ENSP00000271452	0.988	Kinetochore protein Nuf2
13	9606.ENSP00000247191	0.987	Disks large-associated protein 5
14	9606.ENSP00000377793	0.987	Protein regulator of cytokinesis 1
15	9606.ENSP00000296509	0.984	Mitotic spindle assembly checkpoint protein MAD2A
16	9606.ENSP00000362146	0.984	Borealin
17	9606.ENSP00000274026	0.983	Cyclin-A2
18	9606.ENSP00000357643	0.981	Proliferation marker protein Ki-67
19	9606.ENSP00000251496	0.980	Condensin complex subunit 3
20	9606.ENSP00000361298	0.980	Kinesin-like protein KIF2C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003774	0.999	cytoskeletal motor activity
GO:0008017	0.996	microtubule binding
GO:0003777	0.986	microtubule motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0022402	0.967	cell cycle process
GO:0007017	0.956	microtubule-based process
GO:0000278	0.950	mitotic cell cycle
GO:0050794	0.933	regulation of cellular process
GO:0007059	0.923	chromosome segregation
GO:0010564	0.912	regulation of cell cycle process
GO:0000226	0.891	microtubule cytoskeleton organization
GO:0048285	0.862	organelle fission
GO:0051171	0.836	regulation of nitrogen compound metabolic process
GO:0007051	0.833	spindle organization
GO:0098813	0.794	nuclear chromosome segregation
GO:0000280	0.776	nuclear division
GO:0080090	0.774	regulation of primary metabolic process
GO:0051641	0.771	cellular localization
GO:0031323	0.766	regulation of cellular metabolic process
GO:0060255	0.734	regulation of macromolecule metabolic process
GO:0031399	0.681	regulation of protein modification process
GO:0051276	0.663	chromosome organization
GO:1903047	0.630	mitotic cell cycle process
GO:0051174	0.599	regulation of phosphorus metabolic process
GO:0044085	0.580	cellular component biogenesis
GO:0033043	0.516	regulation of organelle organization
GO:0022607	0.510	cellular component assembly
GO:0048518	0.470	positive regulation of biological process
GO:0000819	0.457	sister chromatid segregation
GO:0051983	0.437	regulation of chromosome segregation
GO:0051234	0.353	establishment of localization
GO:1901987	0.345	regulation of cell cycle phase transition
GO:0051649	0.341	establishment of localization in cell
GO:0033044	0.340	regulation of chromosome organization
GO:1901990	0.337	regulation of mitotic cell cycle phase transition
GO:0030071	0.329	regulation of mitotic metaphase/anaphase transition
GO:0048522	0.300	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0099080	0.999	supramolecular complex
GO:0005694	0.999	chromosome
GO:0005856	0.996	cytoskeleton
GO:0015630	0.993	microtubule cytoskeleton
GO:0005829	0.991	cytosol
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0005634	0.980	nucleus
GO:0098687	0.965	chromosomal region
GO:0000793	0.954	condensed chromosome
GO:0000775	0.952	chromosome, centromeric region
GO:0032991	0.922	protein-containing complex
GO:0000776	0.921	kinetochore
GO:0005819	0.841	spindle
GO:0016020	0.778	membrane
GO:0043233	0.690	organelle lumen
GO:0070013	0.667	intracellular organelle lumen
GO:0031981	0.662	nuclear lumen
GO:0099081	0.635	supramolecular polymer
GO:0099512	0.546	supramolecular fiber
GO:0099513	0.539	polymeric cytoskeletal fiber
GO:0005874	0.510	microtubule
GO:0005654	0.440	nucleoplasm
GO:0030496	0.353	midbody
GO:0005815	0.346	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]