StarFunc result for job id Q02246

User Input

>input (1040 residues)
MGTATRRKPHLLLVAAVALVSSSAWSSALGSQTTFGPVFEDQPLSVLFPEESTEEQVLLA
CRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNPTKAQDAGVYQCLASNPVGTV
VSREAILRFGFLQEFSKEERDPVKAHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIPTD
GRHFVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPS
IKARFPAETYALVGQQVTLECFAFGNPVPRIKWRKVDGSLSPQWTTAEPTLQIPSVSFED
EGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPTVRW
LRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYASAELAVQALAPDFR
LNPVRRLIPAARGGEILIPCQPRAAPKAVVLWSKGTEILVNSSRVTVTPDGTLIIRNISR
SDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDL
TFTWTLDDFPIDFDKPGGHYRRTNVKETIGDLTILNAQLRHGGKYTCMAQTVVDSASKEA
TVLVRGPPGPPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNP
ANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSGG
GGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTARVPGADAQYFVYSNESVRP
YTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWEPVQQDM
NGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPAS
PSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPT
LHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPH
PGTVISHSVAMLILIGSLEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QA12	0.531	0.531	0.000	1040	0.534	0.534	A0A2R8QA12.pdb.gz
2	AFDB:A4JYP8	0.430	0.433	0.000	1032	0.456	0.459	A4JYP8.pdb.gz	A4JYP8_DANRE Cntn1a OS=Danio rerio OX=7955 GN=F3 PE=1 SV=1
3	AFDB:B3DH04	0.650	0.650	0.000	1040	0.575	0.575	B3DH04.pdb.gz
4	AFDB:O94779	0.591	0.564	0.000	1100	0.429	0.405	O94779.pdb.gz	CNTN5_HUMAN Contactin-5 OS=Homo sapiens OX=9606 GN=CNTN5 PE=1 SV=2
5	AFDB:P14781	0.672	0.689	0.000	1010	0.488	0.503	P14781.pdb.gz	CNTN1_CHICK Contactin-1 OS=Gallus gallus OX=9031 GN=CNTN1 PE=1 SV=1
6	AFDB:P22063	0.671	0.671	0.000	1040	0.907	0.907	P22063.pdb.gz	CNTN2_RAT Contactin-2 OS=Rattus norvegicus OX=10116 GN=Cntn2 PE=1 SV=1
7	AFDB:P28685	0.773	0.776	0.000	1036	0.736	0.738	P28685.pdb.gz	CNTN2_CHICK Contactin-2 OS=Gallus gallus OX=9031 GN=CNTN2 PE=1 SV=1
8	AFDB:P97528	0.518	0.524	0.000	1028	0.422	0.427	P97528.pdb.gz	CNTN6_RAT Contactin-6 OS=Rattus norvegicus OX=10116 GN=Cntn6 PE=1 SV=1
9	AFDB:Q62682	0.672	0.678	0.000	1028	0.424	0.429	Q62682.pdb.gz	CNTN3_RAT Contactin-3 OS=Rattus norvegicus OX=10116 GN=Cntn3 PE=1 SV=1
10	AFDB:Q62845	0.556	0.562	0.000	1026	0.421	0.427	Q62845.pdb.gz	CNTN4_RAT Contactin-4 OS=Rattus norvegicus OX=10116 GN=Cntn4 PE=1 SV=1
11	PDB:5oj2B	0.139	0.190	7.050E-27	692	0.129	0.194	5oj2B.pdb.gz
12	PDB:1e07A	0.149	0.212	3.550E-19	642	0.116	0.188	1e07A.pdb.gz
13	PDB:7sqcO0	0.138	0.130	5.662E-18	1140	0.093	0.085	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:5a42A	0.104	0.079	2.253E-15	1597	0.111	0.072	5a42A.pdb.gz
15	PDB:7q1yA	0.109	0.091	1.839E-14	1374	0.090	0.068	7q1yA.pdb.gz
16	PDB:6dldD	0.125	0.382	1.255E-13	269	0.068	0.264	6dldD.pdb.gz
17	PDB:7q5zA	0.108	0.088	2.052E-13	1344	0.079	0.061	7q5zA.pdb.gz
18	PDB:6pyhD	0.161	0.204	6.268E-13	798	0.065	0.085	6pyhD.pdb.gz
19	PDB:8dtlA	0.124	0.165	6.554E-13	741	0.042	0.059	8dtlA.pdb.gz
20	PDB:6pxvA	0.124	0.149	1.401E-12	823	0.053	0.067	6pxvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4JYP8	0.0	879	1032	0.460	0.463	A4JYP8_DANRE Cntn1a OS=Danio rerio OX=7955 GN=F3 PE=1 SV=1
2	O94779	0.0	903	1100	0.418	0.395	CNTN5_HUMAN Contactin-5 OS=Homo sapiens OX=9606 GN=CNTN5 PE=1 SV=2
3	P12960	0.0	969	1020	0.487	0.496	CNTN1_MOUSE Contactin-1 OS=Mus musculus OX=10090 GN=Cntn1 PE=1 SV=1
4	P14781	0.0	1001	1010	0.492	0.507	CNTN1_CHICK Contactin-1 OS=Gallus gallus OX=9031 GN=CNTN1 PE=1 SV=1
5	P22063	0.0	1860	1040	0.902	0.902	CNTN2_RAT Contactin-2 OS=Rattus norvegicus OX=10116 GN=Cntn2 PE=1 SV=1
6	P28685	0.0	1591	1036	0.744	0.747	CNTN2_CHICK Contactin-2 OS=Gallus gallus OX=9031 GN=CNTN2 PE=1 SV=1
7	P68500	0.0	892	1098	0.417	0.395	CNTN5_MOUSE Contactin-5 OS=Mus musculus OX=10090 GN=Cntn5 PE=1 SV=2
8	P97528	0.0	863	1028	0.420	0.425	CNTN6_RAT Contactin-6 OS=Rattus norvegicus OX=10116 GN=Cntn6 PE=1 SV=1
9	Q02246	0.0	2148	1040	1.000	1.000	CNTN2_HUMAN Contactin-2 OS=Homo sapiens OX=9606 GN=CNTN2 PE=1 SV=1
10	Q12860	0.0	978	1018	0.487	0.498	CNTN1_HUMAN Contactin-1 OS=Homo sapiens OX=9606 GN=CNTN1 PE=1 SV=1
11	Q61330	0.0	1868	1040	0.900	0.900	CNTN2_MOUSE Contactin-2 OS=Mus musculus OX=10090 GN=Cntn2 PE=1 SV=2
12	Q62682	0.0	899	1028	0.419	0.424	CNTN3_RAT Contactin-3 OS=Rattus norvegicus OX=10116 GN=Cntn3 PE=1 SV=1
13	Q62845	0.0	915	1026	0.421	0.427	CNTN4_RAT Contactin-4 OS=Rattus norvegicus OX=10116 GN=Cntn4 PE=1 SV=1
14	Q63198	0.0	971	1021	0.487	0.496	CNTN1_RAT Contactin-1 OS=Rattus norvegicus OX=10116 GN=Cntn1 PE=1 SV=2
15	Q8IWV2	0.0	901	1026	0.414	0.420	CNTN4_HUMAN Contactin-4 OS=Homo sapiens OX=9606 GN=CNTN4 PE=1 SV=1
16	Q9JMB8	0.0	849	1028	0.412	0.417	CNTN6_MOUSE Contactin-6 OS=Mus musculus OX=10090 GN=Cntn6 PE=1 SV=2
17	Q9P232	0.0	904	1028	0.422	0.427	CNTN3_HUMAN Contactin-3 OS=Homo sapiens OX=9606 GN=CNTN3 PE=1 SV=3
18	Q9UQ52	0.0	858	1028	0.420	0.425	CNTN6_HUMAN Contactin-6 OS=Homo sapiens OX=9606 GN=CNTN6 PE=1 SV=1
19	Q9W675	0.0	1224	1040	0.569	0.569	Q9W675_DANRE Contactin-2 precursor OS=Danio rerio OX=7955 GN=tag1 PE=1 SV=1
20	Q9VN14	1.27e-138	453	1390	0.306	0.229	CONT_DROME Contactin OS=Drosophila melanogaster OX=7227 GN=Cont PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	12	17.0	Adenovirus E3 region protein CR1
2	PF06832 BiPBP_C	4.7	18.7	Penicillin-Binding Protein C-terminus Family
3	PF05790 C2-set	0.19	23.2	Immunoglobulin C2-set domain
4	PF08205 C2-set_2	0.0037	28.6	CD80-like C2-set immunoglobulin domain
5	PF00041 fn3	2.1e-43	157.9	Fibronectin type III domain
6	PF20418 Herpes_gE_N	4.3e+02	12.2	Alphaherpesvirus glycoprotein E N-terminal
7	PF07679 I-set	2.2e-64	224.9	Immunoglobulin I-set domain
8	PF00047 ig	2.7e-50	179.8	Immunoglobulin domain
9	PF13895 Ig_2	1.9e-47	170.8	Immunoglobulin domain
10	PF13927 Ig_3	5.3e-73	252.9	Immunoglobulin domain
11	PF16680 Ig_4	1.5e-06	40.0	T-cell surface glycoprotein CD3 delta chain
12	PF16681 Ig_5	1.9e-07	42.7	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
13	PF18452 Ig_6	0.12	23.7	Immunoglobulin domain
14	PF17736 Ig_C17orf99	0.00041	31.7	C17orf99 Ig domain
15	PF09294 Interfer-bind	1.9e+02	13.8	Interferon-alpha/beta receptor, fibronectin type III
16	PF16706 Izumo-Ig	0.015	26.5	Izumo-like Immunoglobulin domain
17	PF16656 Pur_ac_phosph_N	0.00022	33.2	Purple acid Phosphatase, N-terminal domain
18	PF07686 V-set	5.4e-20	83.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330633

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354778	0.999	Contactin-associated protein-like 2
2	9606.ENSP00000483825	0.989	NF-kappa-B essential modulator
3	9606.ENSP00000284981	0.979	Amyloid-beta A4 protein
4	9606.ENSP00000225525	0.934	Tax1-binding protein 3
5	9606.ENSP00000447488	0.923	Protein lin-7 homolog A
6	9606.ENSP00000480132	0.914	Neural cell adhesion molecule 1
7	9606.ENSP00000368314	0.913	Neuronal cell adhesion molecule
8	9606.ENSP00000005226	0.906	Harmonin
9	9606.ENSP00000252575	0.903	Neurocan core protein
10	9606.ENSP00000359077	0.900	Neural cell adhesion molecule L1
11	9606.ENSP00000387699	0.897	Cyclic AMP-responsive element-binding protein 1
12	9606.ENSP00000264638	0.895	Contactin-associated protein 1
13	9606.ENSP00000360472	0.807	Leucine-rich glioma-inactivated protein 1
14	9606.ENSP00000371985	0.791	Potassium voltage-gated channel subfamily A member 1
15	9606.ENSP00000240055	0.783	Nuclear transcription factor Y subunit beta
16	9606.ENSP00000433109	0.757	Potassium voltage-gated channel subfamily A member 2
17	9606.ENSP00000343158	0.753	Band 4.1-like protein 3
18	9606.ENSP00000345731	0.742	Disks large homolog 1
19	9606.ENSP00000479811	0.740	Contactin-associated protein-like 4
20	9606.ENSP00000377047	0.733	Receptor-type tyrosine-protein phosphatase zeta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.560	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071840	0.986	cellular component organization or biogenesis
GO:0016043	0.981	cellular component organization
GO:0050789	0.970	regulation of biological process
GO:0032501	0.958	multicellular organismal process
GO:0050794	0.952	regulation of cellular process
GO:0050896	0.939	response to stimulus
GO:0007275	0.938	multicellular organism development
GO:0048731	0.919	system development
GO:0007399	0.901	nervous system development
GO:0030182	0.877	neuron differentiation
GO:0031175	0.699	neuron projection development
GO:0061024	0.644	membrane organization
GO:0061564	0.636	axon development
GO:0009653	0.634	anatomical structure morphogenesis
GO:0048812	0.620	neuron projection morphogenesis
GO:0048667	0.609	cell morphogenesis involved in neuron differentiation
GO:0007409	0.595	axonogenesis
GO:0048518	0.494	positive regulation of biological process
GO:0007155	0.452	cell adhesion
GO:0051716	0.384	cellular response to stimulus
GO:0048522	0.323	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0030054	0.872	cell junction
GO:0043226	0.721	organelle
GO:0045202	0.720	synapse
GO:0005622	0.638	intracellular anatomical structure
GO:0043227	0.615	membrane-bounded organelle
GO:0043229	0.602	intracellular organelle
GO:0005737	0.466	cytoplasm
GO:0042995	0.347	cell projection
GO:0098794	0.307	postsynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]