StarFunc result for job id Q02252

User Input

>input (535 residues)
MAALLAAAAVRARILQVSSKVKSSPTWYSASSFSSSVPTVKLFIGGKFVESKSDKWIDIH
NPATNEVIGRVPQATKAEMDAAIASCKRAFPAWADTSVLSRQQVLLRYQQLIKENLKEIA
KLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSITKDMDLYSYRLPLGVCA
GIAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHG
QHEAVNFICDHPDIKAISFVGSNKAGEYIFERGSRHGKRVQANMGAKNHGVVMPDANKEN
TLNQLVGAAFGAAGQRCMALSTAVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLIT
PQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKEEIFG
PVLVVLETETLDEAIQIVNNNPYGNGTAIFTTNGATARKYAHLVDVGQVGVNVPIPVPLP
MFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q07536	0.968	0.965	1.581E-103	537	0.940	0.937	Q07536.pdb.gz	MMSA_BOVIN Methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Bos taurus OX=9913 GN=ALDH6A1 PE=1 SV=1
2	AFDB:P52713	0.913	0.934	1.882E-85	523	0.645	0.660	P52713.pdb.gz	MMSA_CAEEL Probable methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Caenorhabditis elegans OX=6239 GN=alh-8 PE=3 SV=1
3	AFDB:Q54I10	0.944	0.956	5.677E-83	528	0.578	0.585	Q54I10.pdb.gz	MMSA_DICDI Probable methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Dictyostelium discoideum OX=44689 GN=mmsdh PE=3 SV=1
4	AFDB:Q0WM29	0.922	0.814	1.993E-82	607	0.561	0.494	Q0WM29.pdb.gz	MMSA_ARATH Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALDH6B2 PE=1 SV=2
5	AFDB:Q9I702	0.895	0.963	1.195E-67	497	0.432	0.465	Q9I702.pdb.gz	BAUC_PSEAE Malonate-semialdehyde dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=bauC PE=2 SV=1
6	AFDB:O53816	0.896	0.940	3.604E-65	510	0.409	0.429	O53816.pdb.gz	O53816_MYCTU Probable methylmalonate-semialdehyde dehydrogenase MmsA (Methylmalonic acid semialdehyde dehydrogenase) (MMSDH) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mmsA PE=1 SV=1
7	AFDB:Q9VBP6	0.853	0.896	1.534E-50	509	0.260	0.273	Q9VBP6.pdb.gz	Q9VBP6_DROME Succinate-semialdehyde dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Ssadh PE=1 SV=1
8	AFDB:P49189	0.852	0.921	1.009E-49	494	0.256	0.277	P49189.pdb.gz	AL9A1_HUMAN 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3
9	AFDB:Q66I21	0.858	0.941	4.454E-49	487	0.265	0.292	Q66I21.pdb.gz	AL8A1_DANRE 2-aminomuconic semialdehyde dehydrogenase OS=Danio rerio OX=7955 GN=aldh8a1 PE=2 SV=1
10	AFDB:P80668	0.835	0.893	1.245E-48	499	0.258	0.277	P80668.pdb.gz	FEAB_ECOLI Phenylacetaldehyde dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=feaB PE=1 SV=2
11	PDB:4fr8C	0.837	0.901	1.688E-48	496	0.269	0.290	4fr8C.pdb.gz	Vascular Bioactivation of Nitroglycerin by Aldehyde Dehydrogenase-2: REACTION INTERMEDIATES REVEALED BY CRYSTALLOGRAPHY AND MASS SPECTROMETRY.
12	PDB:3jz4A	0.846	0.939	3.349E-48	481	0.241	0.268	3jz4A.pdb.gz	The X-ray crystal structure of Escherichia coli succinic semialdehyde dehydrogenase; structural insights into NADP+/enzyme interactions.
13	PDB:7mjcA	0.850	0.920	1.111E-47	493	0.275	0.298	7mjcA.pdb.gz	Inhibitors targeted to aldehyde dehydrogenase
14	PDB:6vr6D	0.863	0.935	1.564E-47	493	0.262	0.284	6vr6D.pdb.gz	Inhibition, crystal structures, and in-solution oligomeric structure of aldehyde dehydrogenase 9A1.
15	PDB:7yobA	0.838	0.906	2.204E-47	494	0.286	0.310	7yobA.pdb.gz
16	PDB:5izdA	0.856	0.925	2.333E-47	494	0.260	0.281	5izdA.pdb.gz	Structure of wild-type glyceraldehyde dehydrogenase from Thermoplasma acidophilum in complex with NADP
17	PDB:3iwjA	0.856	0.914	4.629E-47	500	0.267	0.286	3iwjA.pdb.gz	Structural and functional characterization of plant aminoaldehyde dehydrogenase from Pisum sativum with a broad specificity for natural and synthetic aminoaldehydes.
18	PDB:5abmA	0.837	0.904	5.816E-47	494	0.273	0.296	5abmA.pdb.gz	Structural, Biochemical, and Computational Studies Reveal the Mechanism of Selective Aldehyde Dehydrogenase 1A1 Inhibition by Cytotoxic Duocarmycin Analogues.
19	PDB:7a6qA	0.843	0.920	7.309E-47	489	0.279	0.305	7a6qA.pdb.gz	A Selective Competitive Inhibitor of Aldehyde Dehydrogenase 1A3 Hinders Cancer Cell Growth, Invasiveness and Stemness In Vitro.
20	PDB:1o9jA	0.846	0.914	1.029E-46	494	0.277	0.300	1o9jA.pdb.gz	Crystal Structure of Eta-Crystallin: Adaptation of a Class 1 Aldehyde Dehydrogenase for a New Role in the Eye Lens

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R6G4	0.0	1112	535	1.000	1.000	A0A024R6G4_HUMAN Testicular tissue protein Li 122 OS=Homo sapiens OX=9606 PE=2 SV=1
2	G3V4Z4	0.0	523	252	0.471	1.000	G3V4Z4_HUMAN Aldehyde dehydrogenase 6 family member A1 OS=Homo sapiens OX=9606 GN=ALDH6A1 PE=1 SV=1
3	P52713	0.0	733	523	0.639	0.654	MMSA_CAEEL Probable methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Caenorhabditis elegans OX=6239 GN=alh-8 PE=3 SV=1
4	Q02252	0.0	1112	535	1.000	1.000	MMSA_HUMAN Methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Homo sapiens OX=9606 GN=ALDH6A1 PE=1 SV=2
5	Q02253	0.0	1033	535	0.938	0.938	MMSA_RAT Methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Rattus norvegicus OX=10116 GN=Aldh6a1 PE=1 SV=1
6	Q07536	0.0	1025	537	0.927	0.924	MMSA_BOVIN Methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Bos taurus OX=9913 GN=ALDH6A1 PE=1 SV=1
7	Q0WM29	0.0	638	607	0.559	0.493	MMSA_ARATH Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALDH6B2 PE=1 SV=2
8	Q54I10	0.0	682	528	0.583	0.591	MMSA_DICDI Probable methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Dictyostelium discoideum OX=44689 GN=mmsdh PE=3 SV=1
9	Q9EQ20	0.0	1033	535	0.935	0.935	MMSA_MOUSE Methylmalonate-semialdehyde/malonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Mus musculus OX=10090 GN=Aldh6a1 PE=1 SV=1
10	Q9I702	4.10e-167	484	497	0.428	0.461	BAUC_PSEAE Malonate-semialdehyde dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=bauC PE=2 SV=1
11	O53816	7.02e-145	428	510	0.407	0.427	O53816_MYCTU Probable methylmalonate-semialdehyde dehydrogenase MmsA (Methylmalonic acid semialdehyde dehydrogenase) (MMSDH) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mmsA PE=1 SV=1
12	Q6L285	7.36e-74	244	493	0.271	0.294	GADH_PICTO D-glyceraldehyde dehydrogenase (NADP(+)) OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3) OX=1122961 GN=PTO0332 PE=1 SV=1
13	Q9HK01	5.22e-72	239	493	0.267	0.290	GADH_THEAC D-glyceraldehyde dehydrogenase (NADP(+)) OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta0809 PE=1 SV=1
14	Q9JLJ3	3.25e-69	232	494	0.271	0.294	AL9A1_RAT 4-trimethylaminobutyraldehyde dehydrogenase OS=Rattus norvegicus OX=10116 GN=Aldh9a1 PE=1 SV=1
15	Q9JLJ2	5.33e-69	231	494	0.277	0.300	AL9A1_MOUSE 4-trimethylaminobutyraldehyde dehydrogenase OS=Mus musculus OX=10090 GN=Aldh9a1 PE=1 SV=1
16	Q9H2A2	3.94e-67	226	487	0.280	0.308	AL8A1_HUMAN 2-aminomuconic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH8A1 PE=1 SV=1
17	P17445	1.56e-66	225	490	0.277	0.302	BETB_ECOLI Betaine aldehyde dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=betB PE=1 SV=3
18	O35945	1.69e-66	225	501	0.292	0.311	AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus OX=10090 GN=Aldh1a7 PE=1 SV=1
19	P24549	4.21e-66	224	501	0.288	0.307	AL1A1_MOUSE Aldehyde dehydrogenase 1A1 OS=Mus musculus OX=10090 GN=Aldh1a1 PE=1 SV=5
20	Q8HYE4	8.84e-66	223	501	0.292	0.311	AL1A1_MACFA Aldehyde dehydrogenase 1A1 OS=Macaca fascicularis OX=9541 GN=ALDH1A1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00171 Aldedh	4e-135	462.6	Aldehyde dehydrogenase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000450436

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265395	0.997	3-hydroxyisobutyrate dehydrogenase, mitochondrial
2	9606.ENSP00000387123	0.984	Alpha-aminoadipic semialdehyde dehydrogenase
3	9606.ENSP00000379865	0.981	Hydroxyacid-oxoacid transhydrogenase, mitochondrial
4	9606.ENSP00000242592	0.975	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
5	9606.ENSP00000419027	0.971	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
6	9606.ENSP00000379845	0.962	4-aminobutyrate aminotransferase, mitochondrial
7	9606.ENSP00000261733	0.961	Aldehyde dehydrogenase, mitochondrial
8	9606.ENSP00000365462	0.959	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
9	9606.ENSP00000359151	0.956	Dihydrolipoamide branched chain transacylase E2
10	9606.ENSP00000231887	0.946	Peroxisomal bifunctional enzyme
11	9606.ENSP00000346827	0.943	4-trimethylaminobutyraldehyde dehydrogenase
12	9606.ENSP00000366927	0.943	Aldehyde dehydrogenase X, mitochondrial
13	9606.ENSP00000345774	0.940	Fatty aldehyde dehydrogenase
14	9606.ENSP00000436585	0.937	Ethylmalonyl-CoA decarboxylase
15	9606.ENSP00000265838	0.932	Acetyl-CoA acetyltransferase, mitochondrial
16	9606.ENSP00000341044	0.931	Acetyl-CoA carboxylase 2
17	9606.ENSP00000333664	0.930	3-ketoacyl-CoA thiolase, peroxisomal
18	9606.ENSP00000231420	0.928	Alanine--glyoxylate aminotransferase 2, mitochondrial
19	9606.ENSP00000293217	0.925	Peroxisomal acyl-coenzyme A oxidase 1
20	9606.ENSP00000356015	0.924	Acetyl-CoA acetyltransferase, cytosolic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016620	0.999	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0005488	0.995	binding
GO:0005515	0.914	protein binding
GO:0004030	0.903	aldehyde dehydrogenase [NAD(P)+] activity
GO:0004029	0.883	aldehyde dehydrogenase (NAD+) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044281	0.996	small molecule metabolic process
GO:0072527	0.988	pyrimidine-containing compound metabolic process
GO:0006206	0.984	pyrimidine nucleobase metabolic process
GO:0019752	0.970	carboxylic acid metabolic process
GO:1901565	0.968	organonitrogen compound catabolic process
GO:0009063	0.960	amino acid catabolic process
GO:1901606	0.888	alpha-amino acid catabolic process
GO:1901361	0.838	organic cyclic compound catabolic process
GO:0009081	0.787	branched-chain amino acid metabolic process
GO:0009083	0.777	branched-chain amino acid catabolic process
GO:0046113	0.590	nucleobase catabolic process
GO:0072529	0.576	pyrimidine-containing compound catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005634	0.971	nucleus
GO:0005759	0.904	mitochondrial matrix
GO:0031981	0.747	nuclear lumen
GO:0005654	0.734	nucleoplasm
GO:0005829	0.714	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.1.-	0.999	With NAD(+) or NADP(+) as acceptor.
EC:1.2.1.5	0.903	aldehyde dehydrogenase [NAD(P)(+)].
RHEA:16185	0.883	an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH
EC:1.2.1.3	0.883	aldehyde dehydrogenase (NAD(+)).

[back to server]