StarFunc result for job id Q02297

User Input

>input (640 residues)
MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGN
DSASANITIVESNEIITGMPASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQ
KRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMMNIANGPHHPN
PPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHT
ESILSESHSVIVMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSYRDSPH
SERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFMEEERPLLL
VTPPRLREKKFDHHPQQFSSFHHNPAHDSNSLPASPLRIVEDEEYETTQEYEPAQEPVKK
LANSRRAKRTKPNGHIANRLEVDSNTSSQSSNSESETEDERVGEDTPFLGIQNPLAASLE
ATPAFRLADSRTNPAGRFSTQEEIQARLSSVIANQDPIAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02297	0.999	0.999	9.279E-88	640	1.000	1.000	Q02297.pdb.gz	NRG1_HUMAN Pro-neuregulin-1, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=3
2	AFDB:P43322	0.203	0.197	8.724E-78	662	0.905	0.875	P43322.pdb.gz	NRG1_RAT Pro-neuregulin-1, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg1 PE=1 SV=1
3	AFDB:B9VQL3	0.157	0.176	3.038E-28	565	0.348	0.395	B9VQL3.pdb.gz
4	AFDB:Q90X22	0.154	0.082	2.719E-10	1276	0.134	0.067	Q90X22.pdb.gz
5	AFDB:Q924C5	0.148	0.059	4.277E-9	1678	0.159	0.061	Q924C5.pdb.gz	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2
6	PDB:4edqA	0.146	0.191	1.097E-8	483	0.041	0.054	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
7	PDB:1cd0A	0.131	0.650	6.464E-7	111	0.022	0.126	1cd0A.pdb.gz
8	PDB:2cd0A	0.135	0.700	6.846E-7	111	0.022	0.126	2cd0A.pdb.gz
9	PDB:3oaiA	0.134	0.174	1.023E-6	488	0.025	0.033	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
10	PDB:6sm1A	0.129	0.639	1.023E-6	111	0.022	0.126	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
11	PDB:5ir3A	0.142	0.747	1.715E-6	111	0.020	0.117	5ir3A.pdb.gz
12	PDB:6dldD	0.132	0.304	1.715E-6	269	0.027	0.063	6dldD.pdb.gz
13	PDB:2jb5L	0.121	0.352	2.038E-6	211	0.034	0.104	2jb5L.pdb.gz	Fab Mor03268 Triggers Absorption Shift of a Diagnostic Dye Via Packaging in a Solvent-Shielded Fab Dimer Interface
14	PDB:1q0xL	0.129	0.358	2.158E-6	212	0.033	0.099	1q0xL.pdb.gz
15	PDB:5c6wJ	0.129	0.325	2.158E-6	238	0.023	0.063	5c6wJ.pdb.gz
16	AFDB:Q0KIB0	0.111	0.046	1.052E-5	1689	0.156	0.059	Q0KIB0.pdb.gz	Q0KIB0_DROME Sidestep III, isoform O OS=Drosophila melanogaster OX=7227 GN=side-III PE=1 SV=1
17	AFDB:O97174	0.126	0.085	1.572E-5	975	0.117	0.077	O97174.pdb.gz	O97174_DROME EG:163A10.1 protein OS=Drosophila melanogaster OX=7227 GN=kirre PE=1 SV=1
18	AFDB:Q9VPZ7	0.149	0.073	9.322E-5	1342	0.156	0.075	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
19	AFDB:Q967D7	0.131	0.058	2.205E-4	1531	0.169	0.071	Q967D7.pdb.gz	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
20	AFDB:Q9P2J2	0.139	0.077	3.112E-4	1179	0.192	0.104	Q9P2J2.pdb.gz	TUTLA_HUMAN Protein turtle homolog A OS=Homo sapiens OX=9606 GN=IGSF9 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C1F8	0.0	1163	607	0.897	0.946	A0A494C1F8_HUMAN Pro-neuregulin-1, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
2	P43322	0.0	992	662	0.883	0.853	NRG1_RAT Pro-neuregulin-1, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg1 PE=1 SV=1
3	Q02297	0.0	1320	640	1.000	1.000	NRG1_HUMAN Pro-neuregulin-1, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=3
4	Q6DR98	0.0	1006	645	0.883	0.876	NRG1_MOUSE Pro-neuregulin-1, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg1 PE=1 SV=1
5	Q6DR99	0.0	742	700	0.656	0.600	Q6DR99_MOUSE Pro-neuregulin-1, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg1 PE=1 SV=1
6	B3DK99	2.29e-161	478	599	0.472	0.504	B3DK99_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=2 SV=1
7	A0A0R4IDP7	2.16e-158	474	725	0.470	0.415	A0A0R4IDP7_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
8	A0A1B4Z255	1.80e-153	457	604	0.469	0.497	A0A1B4Z255_DANRE Neuregulin1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=2 SV=1
9	A0A0R4IPH3	3.34e-152	458	722	0.467	0.414	A0A0R4IPH3_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
10	Q6PK61	1.30e-151	439	241	0.339	0.900	Q6PK61_HUMAN Neuregulin 1 OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
11	A0A0R4IBM0	1.56e-150	454	730	0.467	0.410	A0A0R4IBM0_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
12	A0A0R4IFE6	8.25e-143	433	687	0.411	0.383	A0A0R4IFE6_DANRE Neuregulin 1 OS=Danio rerio OX=7955 GN=wu:fm70e01 PE=3 SV=1
13	A0A494C114	8.25e-120	356	207	0.286	0.884	A0A494C114_HUMAN Neuregulin 1 OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
14	O14511	5.65e-104	337	850	0.328	0.247	NRG2_HUMAN Pro-neuregulin-2, membrane-bound isoform OS=Homo sapiens OX=9606 GN=NRG2 PE=1 SV=1
15	O35569	6.35e-103	334	868	0.338	0.249	NRG2_RAT Pro-neuregulin-2, membrane-bound isoform OS=Rattus norvegicus OX=10116 GN=Nrg2 PE=1 SV=1
16	P56974	1.10e-101	328	756	0.333	0.282	NRG2_MOUSE Pro-neuregulin-2, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg2 PE=1 SV=1
17	A0A494C054	4.84e-91	280	155	0.222	0.916	A0A494C054_HUMAN Neuregulin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
18	A0A494C1G2	3.44e-80	261	387	0.223	0.370	A0A494C1G2_HUMAN Neuregulin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NRG1 PE=1 SV=1
19	A5D6U9	8.43e-65	223	488	0.186	0.244	A5D6U9_DANRE Neuregulin 2a OS=Danio rerio OX=7955 GN=nrg2a PE=2 SV=1
20	O35181	5.10e-18	90.5	713	0.061	0.055	NRG3_MOUSE Pro-neuregulin-3, membrane-bound isoform OS=Mus musculus OX=10090 GN=Nrg3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06832 BiPBP_C	3.3e+02	12.8	Penicillin-Binding Protein C-terminus Family
2	PF10890 Cyt_b-c1_8	4e+02	12.8	Cytochrome b-c1 complex subunit 8
3	PF19904 DUF6377	77	14.3	Domain of unknown function (DUF6377)
4	PF00008 EGF	0.17	23.5	EGF-like domain
5	PF07974 EGF_2	30	16.4	EGF-like domain
6	PF12661 hEGF	78	15.3	Human growth factor-like EGF
7	PF07679 I-set	7.6e-10	50.1	Immunoglobulin I-set domain
8	PF00047 ig	1.6e-06	39.5	Immunoglobulin domain
9	PF13895 Ig_2	0.00018	33.0	Immunoglobulin domain
10	PF13927 Ig_3	3e-07	42.2	Immunoglobulin domain
11	PF16680 Ig_4	1.9e+02	14.1	T-cell surface glycoprotein CD3 delta chain
12	PF18452 Ig_6	47	15.2	Immunoglobulin domain
13	PF02158 Neuregulin	2.4e-161	548.7	Neuregulin intracellular region
14	PF07686 V-set	0.0067	28.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384620

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267101	0.999	Receptor tyrosine-protein kinase erbB-3
2	9606.ENSP00000269571	0.999	Receptor tyrosine-protein kinase erbB-2
3	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
4	9606.ENSP00000342235	0.999	Receptor tyrosine-protein kinase erbB-4
5	9606.ENSP00000265171	0.972	Pro-epidermal growth factor
6	9606.ENSP00000382428	0.962	Disks large homolog 4
7	9606.ENSP00000309968	0.958	Disintegrin and metalloproteinase domain-containing protein 17
8	9606.ENSP00000263025	0.947	Mitogen-activated protein kinase 3
9	9606.ENSP00000477455	0.947	Glutamate receptor ionotropic, NMDA 2B
10	9606.ENSP00000256078	0.944	GTPase KRas
11	9606.ENSP00000407586	0.943	GTPase HRas
12	9606.ENSP00000293190	0.941	Glutamate receptor ionotropic, NMDA 2C
13	9606.ENSP00000379818	0.940	Glutamate receptor ionotropic, NMDA 2A
14	9606.ENSP00000361214	0.938	Pro-neuregulin-3, membrane-bound isoform
15	9606.ENSP00000263967	0.936	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
16	9606.ENSP00000302486	0.930	Dual specificity mitogen-activated protein kinase kinase 1
17	9606.ENSP00000378367	0.930	Pro-neuregulin-4, membrane-bound isoform
18	9606.ENSP00000340944	0.929	Tyrosine-protein phosphatase non-receptor type 11
19	9606.ENSP00000346671	0.928	Tyrosine-protein kinase Fyn
20	9606.ENSP00000376345	0.928	Growth factor receptor-bound protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	0.997	receptor ligand activity
GO:0050839	0.977	cell adhesion molecule binding
GO:0030296	0.969	protein tyrosine kinase activator activity
GO:0005178	0.954	integrin binding
GO:0030297	0.817	transmembrane receptor protein tyrosine kinase activator activity
GO:0008083	0.791	growth factor activity
GO:0140110	0.789	transcription regulator activity
GO:0043125	0.760	ErbB-3 class receptor binding
GO:0005125	0.730	cytokine activity
GO:0003712	0.717	transcription coregulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.972	cellular process
GO:0050794	0.966	regulation of cellular process
GO:0048856	0.965	anatomical structure development
GO:0032501	0.964	multicellular organismal process
GO:0050896	0.962	response to stimulus
GO:0048518	0.948	positive regulation of biological process
GO:0007165	0.945	signal transduction
GO:0048513	0.938	animal organ development
GO:0048522	0.937	positive regulation of cellular process
GO:0030154	0.932	cell differentiation
GO:0048731	0.921	system development
GO:0038127	0.921	ERBB signaling pathway
GO:0033674	0.905	positive regulation of kinase activity
GO:0045860	0.898	positive regulation of protein kinase activity
GO:0051147	0.896	regulation of muscle cell differentiation
GO:0045597	0.887	positive regulation of cell differentiation
GO:0016477	0.882	cell migration
GO:0009653	0.875	anatomical structure morphogenesis
GO:0048468	0.869	cell development
GO:0051149	0.868	positive regulation of muscle cell differentiation
GO:0051153	0.862	regulation of striated muscle cell differentiation
GO:0048523	0.861	negative regulation of cellular process
GO:0051130	0.848	positive regulation of cellular component organization
GO:0051155	0.847	positive regulation of striated muscle cell differentiation
GO:1902533	0.847	positive regulation of intracellular signal transduction
GO:0050731	0.847	positive regulation of peptidyl-tyrosine phosphorylation
GO:0007422	0.842	peripheral nervous system development
GO:0008284	0.835	positive regulation of cell population proliferation
GO:0014706	0.834	striated muscle tissue development
GO:0010033	0.828	response to organic substance
GO:0040012	0.818	regulation of locomotion
GO:0048738	0.799	cardiac muscle tissue development
GO:0032879	0.789	regulation of localization
GO:0016043	0.787	cellular component organization
GO:0042063	0.773	gliogenesis
GO:0010001	0.755	glial cell differentiation
GO:0051240	0.754	positive regulation of multicellular organismal process
GO:0061384	0.750	heart trabecula morphogenesis
GO:0051049	0.731	regulation of transport
GO:0065008	0.730	regulation of biological quality
GO:1901700	0.701	response to oxygen-containing compound
GO:0010468	0.699	regulation of gene expression
GO:0009719	0.680	response to endogenous stimulus
GO:2000026	0.677	regulation of multicellular organismal development
GO:0048762	0.665	mesenchymal cell differentiation
GO:0023057	0.649	negative regulation of signaling
GO:0010648	0.649	negative regulation of cell communication
GO:0007420	0.647	brain development
GO:0009605	0.640	response to external stimulus
GO:0014037	0.631	Schwann cell differentiation
GO:0071704	0.612	organic substance metabolic process
GO:0010556	0.570	regulation of macromolecule biosynthetic process
GO:0031326	0.570	regulation of cellular biosynthetic process
GO:0010605	0.567	negative regulation of macromolecule metabolic process
GO:0055010	0.566	ventricular cardiac muscle tissue morphogenesis
GO:0045165	0.565	cell fate commitment
GO:0035051	0.564	cardiocyte differentiation
GO:0021782	0.561	glial cell development
GO:0048646	0.528	anatomical structure formation involved in morphogenesis
GO:0014044	0.523	Schwann cell development
GO:0044087	0.514	regulation of cellular component biogenesis
GO:0019219	0.501	regulation of nucleobase-containing compound metabolic process
GO:0044238	0.495	primary metabolic process
GO:0048699	0.479	generation of neurons
GO:0030182	0.459	neuron differentiation
GO:0006807	0.447	nitrogen compound metabolic process
GO:0006355	0.425	regulation of DNA-templated transcription
GO:0044237	0.394	cellular metabolic process
GO:0043170	0.394	macromolecule metabolic process
GO:0051046	0.394	regulation of secretion
GO:1901564	0.318	organonitrogen compound metabolic process
GO:0006950	0.307	response to stress
GO:0051179	0.301	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.996	extracellular region
GO:0005654	0.995	nucleoplasm
GO:0005886	0.993	plasma membrane
GO:0030054	0.988	cell junction
GO:0005615	0.979	extracellular space
GO:0005737	0.831	cytoplasm
GO:0045202	0.830	synapse
GO:0098590	0.675	plasma membrane region
GO:0098978	0.512	glutamatergic synapse
GO:0016324	0.347	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]