StarFunc result for job id Q02318

User Input

>input (531 residues)
MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEI
PRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQ
EGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNE
VIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTF
VRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAA
GPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEA
LHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPK
NTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRR
IAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02318	1.000	1.000	1.118E-84	531	1.000	1.000	Q02318.pdb.gz	CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27A1 PE=1 SV=1
2	AFDB:Q9DBG1	0.901	0.898	3.564E-66	533	0.723	0.720	Q9DBG1.pdb.gz	CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27a1 PE=1 SV=1
3	AFDB:P17178	0.918	0.915	6.428E-65	533	0.716	0.713	P17178.pdb.gz	CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27a1 PE=1 SV=1
4	AFDB:O35084	0.858	0.897	9.193E-44	507	0.348	0.365	O35084.pdb.gz	CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27b1 PE=1 SV=2
5	AFDB:A0A140LGN8	0.846	0.886	1.211E-43	506	0.379	0.397	A0A140LGN8.pdb.gz
6	AFDB:Q4G0S4	0.865	0.848	1.595E-43	542	0.360	0.352	Q4G0S4.pdb.gz	C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens OX=9606 GN=CYP27C1 PE=1 SV=3
7	AFDB:O15528	0.845	0.882	2.199E-43	508	0.379	0.396	O15528.pdb.gz	CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27B1 PE=1 SV=1
8	AFDB:O73684	0.799	0.833	5.010E-36	508	0.290	0.303	O73684.pdb.gz	O73684_CHICK 25-hydroxyvitamin D3 24-hydroxylase OS=Gallus gallus OX=9031 GN=cP450cc24 PE=2 SV=1
9	AFDB:Q09128	0.787	0.812	9.905E-35	514	0.305	0.315	Q09128.pdb.gz	CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp24a1 PE=1 SV=1
10	AFDB:P05108	0.843	0.858	5.670E-34	521	0.266	0.271	P05108.pdb.gz	CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11A1 PE=1 SV=2
11	PDB:3k9vA	0.773	0.878	1.134E-32	464	0.290	0.332	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
12	PDB:3na1A	0.831	0.931	1.782E-31	472	0.245	0.275	3na1A.pdb.gz	Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.
13	PDB:3mzsA	0.815	0.916	8.431E-30	470	0.249	0.281	3mzsA.pdb.gz	Structural Basis for Three-step Sequential Catalysis by the Cholesterol Side Chain Cleavage Enzyme CYP11A1.
14	PDB:7m8iA	0.781	0.728	7.295E-29	572	0.249	0.231	7m8iA.pdb.gz	Structural and functional insights into aldosterone synthase interaction with its redox partner protein adrenodoxin.
15	PDB:7mk8B	0.712	0.806	1.752E-22	465	0.209	0.239	7mk8B.pdb.gz	Structural Basis for the Diminished Ligand Binding and Catalytic Ability of Human Fetal-Specific CYP3A7.
16	PDB:5te8B	0.642	0.717	1.050E-21	471	0.207	0.234	5te8B.pdb.gz	Structural basis for regiospecific midazolam oxidation by human cytochrome P450 3A4.
17	PDB:2j0dB	0.651	0.768	1.587E-21	445	0.202	0.240	2j0dB.pdb.gz	Structural Basis for Ligand Promiscuity in Cytochrome P450 3A4
18	PDB:5veuC	0.689	0.774	4.162E-21	469	0.211	0.239	5veuC.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
19	PDB:7kvjA	0.634	0.800	8.287E-21	415	0.194	0.248	7kvjA.pdb.gz	Rational Design of CYP3A4 Inhibitors: A One-Atom Linker Elongation in Ritonavir-Like Compounds Leads to a Marked Improvement in the Binding Strength.
20	PDB:4y8wC	0.689	0.816	1.092E-20	442	0.192	0.231	4y8wC.pdb.gz	Human Cytochrome P450 21A2, the Major Steroid 21-Hydroxylase: STRUCTURE OF THE ENZYMEPROGESTERONE SUBSTRATE COMPLEX AND RATE-LIMITING C-H BOND CLEAVAGE.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17178	0.0	792	533	0.733	0.730	CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27a1 PE=1 SV=1
2	Q02318	0.0	1098	531	1.000	1.000	CP27A_HUMAN Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27A1 PE=1 SV=1
3	Q9DBG1	0.0	778	533	0.723	0.720	CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27a1 PE=1 SV=1
4	A0A097HUX0	2.60e-132	395	505	0.373	0.392	A0A097HUX0_DANRE 25-hydroxyvitamin D-1alpha-hydroxylase OS=Danio rerio OX=7955 GN=cyp27b1 PE=2 SV=1
5	Q4G0S4	6.94e-119	362	542	0.331	0.325	C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens OX=9606 GN=CYP27C1 PE=1 SV=3
6	O15528	1.94e-114	350	508	0.367	0.384	CP27B_HUMAN 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP27B1 PE=1 SV=1
7	O35132	1.55e-112	345	501	0.360	0.381	CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp27b1 PE=2 SV=2
8	O35084	1.29e-108	335	507	0.363	0.381	CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp27b1 PE=1 SV=2
9	Q64441	1.61e-83	270	514	0.311	0.321	CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus OX=10090 GN=Cyp24a1 PE=2 SV=1
10	Q07973	4.81e-83	269	514	0.298	0.307	CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens OX=9606 GN=CYP24A1 PE=1 SV=2
11	Q09128	9.39e-81	263	514	0.292	0.302	CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp24a1 PE=1 SV=1
12	O73684	1.67e-80	262	508	0.275	0.287	O73684_CHICK 25-hydroxyvitamin D3 24-hydroxylase OS=Gallus gallus OX=9031 GN=cP450cc24 PE=2 SV=1
13	Q90X62	6.62e-66	219	351	0.228	0.345	Q90X62_CHICK Mitochondrial vitamin D 24-hydroxylase variant OS=Gallus gallus OX=9031 GN=CYP24 PE=2 SV=2
14	P00189	1.66e-64	220	520	0.281	0.287	CP11A_BOVIN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Bos taurus OX=9913 GN=CYP11A1 PE=1 SV=1
15	Q7SYJ6	8.12e-60	207	509	0.235	0.246	Q7SYJ6_DANRE Cholesterol side-chain cleavage enzyme, mitochondrial OS=Danio rerio OX=7955 GN=cyp11a1.1 PE=1 SV=1
16	P05108	9.37e-60	207	521	0.267	0.273	CP11A_HUMAN Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=CYP11A1 PE=1 SV=2
17	A1XRK1	1.65e-57	201	518	0.266	0.272	A1XRK1_DANRE Cytochrome P450, family 11, subfamily C, polypeptide 1 OS=Danio rerio OX=7955 GN=cyp11b2 PE=1 SV=1
18	P14137	8.87e-57	200	526	0.282	0.285	CP11A_RAT Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus OX=10116 GN=Cyp11a1 PE=1 SV=1
19	Q3TG86	1.36e-56	199	501	0.245	0.259	Q3TG86_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=1 SV=1
20	Q3TR45	1.70e-56	198	498	0.245	0.261	Q3TR45_MOUSE steroid 11beta-monooxygenase OS=Mus musculus OX=10090 GN=Cyp11b1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	9.7e-113	389.0	Cytochrome P450

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258415

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301645	0.988	Cholesterol 7-alpha-monooxygenase
2	9606.ENSP00000360918	0.961	Cholesterol 25-hydroxylase
3	9606.ENSP00000263093	0.948	Bile acyl-CoA synthetase
4	9606.ENSP00000261835	0.947	Cholesterol 24-hydroxylase
5	9606.ENSP00000310721	0.940	25-hydroxycholesterol 7-alpha-hydroxylase
6	9606.ENSP00000318867	0.938	7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
7	9606.ENSP00000369814	0.932	Aldo-keto reductase family 1 member C4
8	9606.ENSP00000347717	0.926	7-dehydrocholesterol reductase
9	9606.ENSP00000356591	0.863	Sterol O-acyltransferase 1
10	9606.ENSP00000337354	0.861	Lysosomal acid lipase/cholesteryl ester hydrolase
11	9606.ENSP00000301466	0.858	Sterol O-acyltransferase 2
12	9606.ENSP00000360316	0.857	Delta(24)-sterol reductase
13	9606.ENSP00000260270	0.840	Adrenodoxin, mitochondrial
14	9606.ENSP00000361151	0.826	Bile salt-activated lipase
15	9606.ENSP00000304592	0.768	Fatty acid synthase
16	9606.ENSP00000318684	0.764	V-set and immunoglobulin domain containing 2
17	9606.ENSP00000356842	0.764	Cell surface A33 antigen
18	9606.ENSP00000302961	0.745	Heat shock protein family A member 4
19	9606.ENSP00000447149	0.729	Bile acid receptor
20	9606.ENSP00000416515	0.726	NADPH:adrenodoxin oxidoreductase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016705	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0008395	1.000	steroid hydroxylase activity
GO:0020037	0.999	heme binding
GO:0016709	0.867	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0005515	0.631	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044281	0.995	small molecule metabolic process
GO:0008202	0.991	steroid metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0006066	0.987	alcohol metabolic process
GO:1902652	0.976	secondary alcohol metabolic process
GO:0008203	0.955	cholesterol metabolic process
GO:0009058	0.923	biosynthetic process
GO:1901576	0.889	organic substance biosynthetic process
GO:0006694	0.858	steroid biosynthetic process
GO:1901617	0.857	organic hydroxy compound biosynthetic process
GO:0016042	0.838	lipid catabolic process
GO:0044283	0.757	small molecule biosynthetic process
GO:0006766	0.716	vitamin metabolic process
GO:0065007	0.714	biological regulation
GO:0046165	0.690	alcohol biosynthetic process
GO:0006706	0.636	steroid catabolic process
GO:0043436	0.412	oxoacid metabolic process
GO:0019752	0.386	carboxylic acid metabolic process
GO:0032787	0.369	monocarboxylic acid metabolic process
GO:0050896	0.306	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005739	0.992	mitochondrion
GO:0016020	0.986	membrane
GO:0070013	0.986	intracellular organelle lumen
GO:0031090	0.950	organelle membrane
GO:0012505	0.933	endomembrane system
GO:0005634	0.334	nucleus
GO:0031975	0.303	envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	1.000	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
RHEA:43836	1.000	cholesterol + H(+) + NADPH + O2 = 26-hydroxycholesterol + H2O + NADP(+)
EC:1.14.13.-	0.867	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.

[back to server]