StarFunc result for job id Q02363

User Input

>input (134 residues)
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O73933	0.594	0.594	5.534E-18	134	0.940	0.940	O73933.pdb.gz	O73933_CHICK Id2 OS=Gallus gallus OX=9031 GN=ID2 PE=2 SV=1
2	AFDB:Q9PWJ5	0.578	0.582	3.447E-16	133	0.813	0.820	Q9PWJ5.pdb.gz	ID2A_XENLA DNA-binding protein inhibitor ID-2-A OS=Xenopus laevis OX=8355 GN=id2-a PE=2 SV=1
3	AFDB:Q7SZQ2	0.483	0.474	1.167E-14	137	0.806	0.788	Q7SZQ2.pdb.gz	Q7SZQ2_DANRE DNA-binding protein inhibitor ID-2 OS=Danio rerio OX=7955 GN=id2 PE=2 SV=1
4	AFDB:Q7ZXF3	0.384	0.392	7.288E-8	131	0.530	0.542	Q7ZXF3.pdb.gz	ID4_XENLA DNA-binding protein inhibitor ID-4 OS=Xenopus laevis OX=8355 GN=id4 PE=2 SV=1
5	AFDB:P41134	0.467	0.410	2.640E-7	155	0.448	0.387	P41134.pdb.gz	ID1_HUMAN DNA-binding protein inhibitor ID-1 OS=Homo sapiens OX=9606 GN=ID1 PE=1 SV=3
6	AFDB:P20067	0.393	0.322	1.759E-6	168	0.418	0.333	P20067.pdb.gz	ID1_MOUSE DNA-binding protein inhibitor ID-1 OS=Mus musculus OX=10090 GN=Id1 PE=1 SV=3
7	AFDB:P41139	0.385	0.324	3.024E-6	161	0.463	0.385	P41139.pdb.gz	ID4_MOUSE DNA-binding protein inhibitor ID-4 OS=Mus musculus OX=10090 GN=Id4 PE=1 SV=1
8	AFDB:Q32PN8	0.389	0.412	4.540E-6	126	0.463	0.492	Q32PN8.pdb.gz	Q32PN8_DANRE DNA-binding protein inhibitor ID-4 OS=Danio rerio OX=7955 GN=zgc:123214 PE=2 SV=1
9	AFDB:Q8QFX4	0.388	0.445	6.816E-6	116	0.493	0.569	Q8QFX4.pdb.gz	Q8QFX4_DANRE DNA-binding protein inhibitor ID-3 OS=Danio rerio OX=7955 GN=ik:tdsubc_2g3 PE=2 SV=1
10	AFDB:Q90X14	0.402	0.429	2.827E-5	125	0.373	0.400	Q90X14.pdb.gz	Q90X14_CHICK Helix-loop-helix protein OS=Gallus gallus OX=9031 GN=Id3 PE=2 SV=1
11	PDB:7suk5	0.202	0.113	2.209	296	0.112	0.051	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
12	PDB:2rvqD	0.213	0.219	2.897	129	0.112	0.116	2rvqD.pdb.gz
13	PDB:5nrlV	0.202	0.213	3.549	127	0.075	0.079	5nrlV.pdb.gz	Structure of a pre-catalytic spliceosome.
14	PDB:6wg3C	0.174	0.111	4.349	248	0.112	0.060	6wg3C.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
15	PDB:5wlcNE	0.147	0.140	4.654	158	0.090	0.076	5wlcNE.pdb.gz	The complete structure of the small-subunit processome.
16	PDB:6uxwA	0.152	0.038	4.654	778	0.142	0.024	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
17	PDB:3ojaA	0.216	0.075	5.329	482	0.067	0.019	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
18	PDB:5bk4D	0.176	0.051	5.703	661	0.172	0.035	5bk4D.pdb.gz	Cryo-EM structure of Mcm2-7 double hexamer on DNA suggests a lagging-strand DNA extrusion model.
19	PDB:7ktrE	0.205	0.217	5.703	124	0.097	0.105	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
20	PDB:1ek8A	0.128	0.096	7.477	185	0.052	0.038	1ek8A.pdb.gz	Crystal structure of the ribosome recycling factor from Escherichia coli.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q02363	2.40e-95	272	134	1.000	1.000	ID2_HUMAN DNA-binding protein inhibitor ID-2 OS=Homo sapiens OX=9606 GN=ID2 PE=1 SV=1
2	P41136	3.00e-94	269	134	0.985	0.985	ID2_MOUSE DNA-binding protein inhibitor ID-2 OS=Mus musculus OX=10090 GN=Id2 PE=1 SV=3
3	P41137	1.39e-93	268	134	0.978	0.978	ID2_RAT DNA-binding protein inhibitor ID-2 OS=Rattus norvegicus OX=10116 GN=Id2 PE=1 SV=1
4	O73933	5.96e-91	261	134	0.940	0.940	O73933_CHICK Id2 OS=Gallus gallus OX=9031 GN=ID2 PE=2 SV=1
5	Q3LSV1	6.74e-90	258	134	0.925	0.925	Q3LSV1_COTJA Id2 OS=Coturnix japonica OX=93934 GN=Id2 PE=2 SV=1
6	Q9PWJ5	2.05e-73	216	133	0.836	0.842	ID2A_XENLA DNA-binding protein inhibitor ID-2-A OS=Xenopus laevis OX=8355 GN=id2-a PE=2 SV=1
7	Q7SZQ2	5.03e-70	208	137	0.806	0.788	Q7SZQ2_DANRE DNA-binding protein inhibitor ID-2 OS=Danio rerio OX=7955 GN=id2 PE=2 SV=1
8	Q7ZXF3	3.43e-36	122	131	0.493	0.504	ID4_XENLA DNA-binding protein inhibitor ID-4 OS=Xenopus laevis OX=8355 GN=id4 PE=2 SV=1
9	Q90X14	3.04e-35	120	125	0.515	0.552	Q90X14_CHICK Helix-loop-helix protein OS=Gallus gallus OX=9031 GN=Id3 PE=2 SV=1
10	Q8QFX4	5.96e-30	106	116	0.418	0.483	Q8QFX4_DANRE DNA-binding protein inhibitor ID-3 OS=Danio rerio OX=7955 GN=ik:tdsubc_2g3 PE=2 SV=1
11	Q6IQW5	6.33e-30	106	128	0.425	0.445	Q6IQW5_DANRE DNA-binding protein inhibitor ID-1 OS=Danio rerio OX=7955 GN=cb108 PE=1 SV=1
12	Q91399	1.59e-29	105	118	0.507	0.576	ID3A_XENLA DNA-binding protein inhibitor ID-3-A OS=Xenopus laevis OX=8355 GN=id3-a PE=1 SV=1
13	Q32PN8	7.32e-29	103	126	0.448	0.476	Q32PN8_DANRE DNA-binding protein inhibitor ID-4 OS=Danio rerio OX=7955 GN=zgc:123214 PE=2 SV=1
14	P41134	1.49e-27	101	155	0.425	0.368	ID1_HUMAN DNA-binding protein inhibitor ID-1 OS=Homo sapiens OX=9606 GN=ID1 PE=1 SV=3
15	P41135	1.44e-26	99.4	164	0.433	0.354	ID1_RAT DNA-binding protein inhibitor ID-1 OS=Rattus norvegicus OX=10116 GN=Id1 PE=1 SV=1
16	P20067	4.31e-26	98.2	168	0.433	0.345	ID1_MOUSE DNA-binding protein inhibitor ID-1 OS=Mus musculus OX=10090 GN=Id1 PE=1 SV=3
17	P47928	3.73e-24	92.8	161	0.366	0.304	ID4_HUMAN DNA-binding protein inhibitor ID-4 OS=Homo sapiens OX=9606 GN=ID4 PE=1 SV=1
18	Q02535	2.41e-23	89.7	119	0.403	0.454	ID3_HUMAN DNA-binding protein inhibitor ID-3 OS=Homo sapiens OX=9606 GN=ID3 PE=1 SV=2
19	P41139	2.72e-23	90.9	161	0.343	0.286	ID4_MOUSE DNA-binding protein inhibitor ID-4 OS=Mus musculus OX=10090 GN=Id4 PE=1 SV=1
20	P41138	1.35e-22	87.8	119	0.410	0.462	ID3_RAT DNA-binding protein inhibitor ID-3 OS=Rattus norvegicus OX=10116 GN=Id3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	1.2e-10	52.5	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008591780.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008588842.1	0.987	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
2	482537.XP_008563884.1	0.871	Transcription factor 4-like
3	482537.XP_008567467.1	0.871	Transcription factor 4 isoform X1
4	482537.XP_008571141.1	0.857	DNA-binding protein inhibitor ID-3
5	482537.XP_008585668.1	0.851	DNA-binding protein inhibitor ID-1
6	482537.XP_008587875.1	0.830	Transcription factor 12-like
7	482537.XP_008574768.1	0.762	Achaete-scute homolog 1
8	482537.XP_008563103.1	0.712	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
9	482537.XP_008572478.1	0.712	Polycystin-2
10	482537.XP_008590531.1	0.708	E3 SUMO-protein ligase EGR2
11	482537.XP_008573620.1	0.692	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 20 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
12	482537.XP_008574909.1	0.678	Retinoblastoma-associated protein
13	482537.XP_008578463.1	0.672	Bone morphogenetic protein 3
14	482537.XP_008564716.1	0.671	Protein C-ets-1
15	482537.XP_008573676.1	0.628	Myoblast determination protein 1
16	482537.XP_008573679.1	0.628	Myoblast determination protein 1-like
17	482537.XP_008580692.1	0.593	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 27 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
18	482537.XP_008562825.1	0.590	Collagen alpha-3(VI) chain-like
19	482537.XP_008577531.1	0.590	Protein lyl-1
20	482537.XP_008584327.1	0.590	Collagen alpha-3(VI) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.996	molecular function regulator activity
GO:0140416	0.991	transcription regulator inhibitor activity
GO:0140110	0.859	transcription regulator activity
GO:1901363	0.852	heterocyclic compound binding
GO:0097159	0.852	organic cyclic compound binding
GO:0003676	0.841	nucleic acid binding
GO:0003677	0.817	DNA binding
GO:0003700	0.809	DNA-binding transcription factor activity
GO:0043565	0.784	sequence-specific DNA binding
GO:0003690	0.675	double-stranded DNA binding
GO:1990837	0.597	sequence-specific double-stranded DNA binding
GO:0000976	0.539	transcription cis-regulatory region binding
GO:0000981	0.468	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.395	transcription factor binding
GO:0061629	0.337	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000977	0.332	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006355	0.989	regulation of DNA-templated transcription
GO:0048856	0.988	anatomical structure development
GO:0031327	0.988	negative regulation of cellular biosynthetic process
GO:0051253	0.987	negative regulation of RNA metabolic process
GO:0006357	0.978	regulation of transcription by RNA polymerase II
GO:0032501	0.977	multicellular organismal process
GO:0048518	0.974	positive regulation of biological process
GO:0045892	0.971	negative regulation of DNA-templated transcription
GO:0007275	0.942	multicellular organism development
GO:0048522	0.941	positive regulation of cellular process
GO:0030154	0.932	cell differentiation
GO:0050896	0.921	response to stimulus
GO:0048731	0.834	system development
GO:0051716	0.798	cellular response to stimulus
GO:0009893	0.763	positive regulation of metabolic process
GO:0010604	0.734	positive regulation of macromolecule metabolic process
GO:0031325	0.703	positive regulation of cellular metabolic process
GO:0051173	0.622	positive regulation of nitrogen compound metabolic process
GO:0042221	0.614	response to chemical
GO:0048513	0.569	animal organ development
GO:0045595	0.528	regulation of cell differentiation
GO:0042127	0.485	regulation of cell population proliferation
GO:0051239	0.483	regulation of multicellular organismal process
GO:0000122	0.482	negative regulation of transcription by RNA polymerase II
GO:0045935	0.465	positive regulation of nucleobase-containing compound metabolic process
GO:1902680	0.455	positive regulation of RNA biosynthetic process
GO:0007154	0.452	cell communication
GO:0045893	0.452	positive regulation of DNA-templated transcription
GO:0023052	0.426	signaling
GO:0065009	0.415	regulation of molecular function
GO:0007165	0.380	signal transduction
GO:0048583	0.371	regulation of response to stimulus
GO:0045944	0.324	positive regulation of transcription by RNA polymerase II
GO:0009719	0.312	response to endogenous stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005737	0.975	cytoplasm
GO:0031981	0.935	nuclear lumen
GO:0005654	0.929	nucleoplasm
GO:0005829	0.917	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]