StarFunc result for job id Q02383

User Input

>input (582 residues)
MKSIILFVLSLLLILEKQAAVMGQKGGSKGQLPSGSSQFPHGQKGQHYFGQKDQQHTKSK
GSFSIQHTYHVDINDHDWTRKSQQYDLNALHKATKSKQHLGGSQQLLNYKQEGRDHDKSK
GHFHMIVIHHKGGQAHHGTQNPSQDQGNSPSGKGLSSQCSNTEKRLWVHGLSKEQASASG
AQKGRTQGGSQSSYVLQTEELVVNKQQRETKNSHQNKGHYQNVVDVREEHSSKLQTSLHP
AHQDRLQHGPKDIFTTQDELLVYNKNQHQTKNLSQDQEHGRKAHKISYPSSRTEERQLHH
GEKSVQKDVSKGSISIQTEEKIHGKSQNQVTIHSQDQEHGHKENKISYQSSSTEERHLNC
GEKGIQKGVSKGSISIQTEEQIHGKSQNQVRIPSQAQEYGHKENKISYQSSSTEERRLNS
GEKDVQKGVSKGSISIQTEEKIHGKSQNQVTIPSQDQEHGHKENKMSYQSSSTEERRLNY
GGKSTQKDVSQSSISFQIEKLVEGKSQIQTPNPNQDQWSGQNAKGKSGQSADSKQDLLSH
EQKGRYKQESSESHNIVITEHEVAQDDHLTQQYNEDRNPIST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02383	1.000	1.000	1.488E-81	582	1.000	1.000	Q02383.pdb.gz	SEMG2_HUMAN Semenogelin-2 OS=Homo sapiens OX=9606 GN=SEMG2 PE=1 SV=1
2	AFDB:P04279	0.071	0.085	1.838E-40	462	0.624	0.786	P04279.pdb.gz	SEMG1_HUMAN Semenogelin-1 OS=Homo sapiens OX=9606 GN=SEMG1 PE=1 SV=2
3	AFDB:F1LW07	0.058	0.038	4.912E-1	825	0.127	0.090	F1LW07.pdb.gz	F1LW07_RAT Protein phosphatase 1, regulatory subunit 13 like OS=Rattus norvegicus OX=10116 GN=Ppp1r13l PE=1 SV=2
4	AFDB:A0A0K3AUE4	0.056	0.022	7.385E-1	1968	0.148	0.044	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
5	AFDB:Q58FB8	0.053	0.035	8.694E-1	1068	0.148	0.081	Q58FB8.pdb.gz	Q58FB8_DANRE Large tumor suppressor OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1
6	AFDB:A0A2R8QMN6	0.074	0.045	9.433E-1	1069	0.158	0.086	A0A2R8QMN6.pdb.gz
7	AFDB:Q8BMB0	0.057	0.034	9.433E-1	1264	0.151	0.070	Q8BMB0.pdb.gz	EMSY_MOUSE BRCA2-interacting transcriptional repressor EMSY OS=Mus musculus OX=10090 GN=Emsy PE=1 SV=2
8	AFDB:Q149B8	0.055	0.048	1.205	807	0.139	0.100	Q149B8.pdb.gz	PERM1_MOUSE PGC-1 and ERR-induced regulator in muscle protein 1 OS=Mus musculus OX=10090 GN=Perm1 PE=1 SV=2
9	AFDB:Q6QU65	0.054	0.035	1.418	1407	0.136	0.056	Q6QU65.pdb.gz	Q6QU65_DROME ADAM metalloprotease OS=Drosophila melanogaster OX=7227 GN=Meltrin PE=1 SV=1
10	AFDB:Q7TT18	0.066	0.034	1.418	1306	0.156	0.070	Q7TT18.pdb.gz	MCAF1_MOUSE Activating transcription factor 7-interacting protein 1 OS=Mus musculus OX=10090 GN=Atf7ip PE=1 SV=1
11	PDB:6ke6A8	0.034	0.036	9.362	548	0.005	0.005	6ke6A8.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P04279	0.0	620	462	0.562	0.708	SEMG1_HUMAN Semenogelin-1 OS=Homo sapiens OX=9606 GN=SEMG1 PE=1 SV=2
2	Q02383	0.0	1166	582	1.000	1.000	SEMG2_HUMAN Semenogelin-2 OS=Homo sapiens OX=9606 GN=SEMG2 PE=1 SV=1
3	Q8C1W4	2.66e-07	55.5	375	0.069	0.107	Q8C1W4_MOUSE Seminal vesicle secretory protein 2 OS=Mus musculus OX=10090 GN=Semg1 PE=2 SV=1
4	Q8BS30	3.89e-07	54.7	375	0.069	0.107	Q8BS30_MOUSE Semenogelin 1 OS=Mus musculus OX=10090 GN=Semg1 PE=1 SV=1
5	Q3UN62	3.96e-07	54.7	375	0.069	0.107	Q3UN62_MOUSE Seminal vesicle secretory protein 2 OS=Mus musculus OX=10090 GN=Semg1 PE=2 SV=1
6	Q3B802	4.22e-07	55.1	409	0.069	0.098	Q3B802_MOUSE Svs2 protein (Fragment) OS=Mus musculus OX=10090 GN=Semg1 PE=2 SV=1
7	Q8CBV5	7.06e-06	50.8	375	0.067	0.104	Q8CBV5_MOUSE Seminal vesicle secretory protein 2 OS=Mus musculus OX=10090 GN=Semg1 PE=2 SV=1
8	I1XB05	2.2	33.1	242	0.072	0.174	I1XB05_HELAM Adenylate kinase OS=Helicoverpa armigera OX=29058 GN=AK2 PE=2 SV=1
9	Q9ULJ7	7.6	32.0	1429	0.046	0.019	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
10	Q03400	7.7	32.0	585	0.137	0.137	SANT_PLAF7 S-antigen protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF10_0343 PE=2 SV=2
11	Q3MI94	9.5	31.6	394	0.048	0.071	Q3MI94_HUMAN ZNF578 protein (Fragment) OS=Homo sapiens OX=9606 GN=ZNF578 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01006 HCV_NS4a	48	15.1	Hepatitis C virus non-structural protein NS4a
2	PF05474 Semenogelin	0	1350.9	Semenogelin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361855

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361871	0.827	WAP four-disulfide core domain protein 12
2	9606.ENSP00000314151	0.761	Prostate-specific antigen
3	9606.ENSP00000351327	0.709	A-kinase anchor protein 4
4	9606.ENSP00000361735	0.694	WAP four-disulfide core domain containing
5	9606.ENSP00000279058	0.662	Serine peptidase inhibitor, Kunitz type 4
6	9606.ENSP00000243924	0.654	Elafin
7	9606.ENSP00000480750	0.631	Zonadhesin
8	9606.ENSP00000313581	0.612	Kallikrein-2
9	9606.ENSP00000253673	0.611	Adhesion G protein-coupled receptor E3
10	9606.ENSP00000342082	0.607	Antileukoproteinase
11	9606.ENSP00000308595	0.605	Olfactory receptor 5R1
12	9606.ENSP00000341765	0.581	Spermatogenesis-associated protein 16
13	9606.ENSP00000265563	0.561	cAMP-dependent protein kinase type II-alpha regulatory subunit
14	9606.ENSP00000361875	0.540	WAP four-disulfide core domain protein 5
15	9606.ENSP00000361755	0.528	WAP four-disulfide core domain containing
16	9606.ENSP00000403681	0.512	Protamine-2
17	9606.ENSP00000291009	0.503	Prolactin induced protein
18	9606.ENSP00000333203	0.501	Plasma serine protease inhibitor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002020	1.000	protease binding
GO:0008270	1.000	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0065009	0.983	regulation of molecular function
GO:0006952	0.983	defense response
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0044419	0.980	biological process involved in interspecies interaction between organisms
GO:0080090	0.974	regulation of primary metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0010604	0.971	positive regulation of macromolecule metabolic process
GO:0006955	0.965	immune response
GO:0030162	0.961	regulation of proteolysis
GO:0050790	0.959	regulation of catalytic activity
GO:0098542	0.947	defense response to other organism
GO:0050817	0.945	coagulation
GO:0051336	0.936	regulation of hydrolase activity
GO:0006959	0.899	humoral immune response
GO:0045862	0.873	positive regulation of proteolysis
GO:0019730	0.867	antimicrobial humoral response
GO:0052547	0.856	regulation of peptidase activity
GO:0044093	0.815	positive regulation of molecular function
GO:0043085	0.814	positive regulation of catalytic activity
GO:0019731	0.802	antibacterial humoral response
GO:0052548	0.797	regulation of endopeptidase activity
GO:0010952	0.760	positive regulation of peptidase activity
GO:0010950	0.694	positive regulation of endopeptidase activity
GO:0050794	0.591	regulation of cellular process
GO:0009987	0.571	cellular process
GO:0048519	0.518	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070062	1.000	extracellular exosome
GO:0032991	0.657	protein-containing complex
GO:0005737	0.440	cytoplasm
GO:0043233	0.371	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]