StarFunc result for job id Q02388

User Input

>input (1400 residues)
MTLRLLVAALCAGILAEAPRVRAQHRERVTCTRLYAADIVFLLDGSSSIGRSNFREVRSF
LEGLVLPFSGAASAQGVRFATVQYSDDPRTEFGLDALGSGGDVIRAIRELSYKGGNTRTG
AAILHVADHVFLPQLARPGVPKVCILITDGKSQDLVDTAAQRLKGQGVKLFAVGIKNADP
EELKRVASQPTSDFFFFVNDFSILRTLLPLVSRRVCTTAGGVPVTRPPDDSTSAPRDLVL
SEPSSQSLRVQWTAASGPVTGYKVQYTPLTGLGQPLPSERQEVNVPAGETSVRLRGLRPL
TEYQVTVIALYANSIGEAVSGTARTTALEGPELTIQNTTAHSLLVAWRSVPGATGYRVTW
RVLSGGPTQQQELGPGQGSVLLRDLEPGTDYEVTVSTLFGRSVGPATSLMARTDASVEQT
LRPVILGPTSILLSWNLVPEARGYRLEWRRETGLEPPQKVVLPSDVTRYQLDGLQPGTEY
RLTLYTLLEGHEVATPATVVPTGPELPVSPVTDLQATELPGQRVRVSWSPVPGATQYRII
VRSTQGVERTLVLPGSQTAFDLDDVQAGLSYTVRVSARVGPREGSASVLTVRREPETPLA
VPGLRVVVSDATRVRVAWGPVPGASGFRISWSTGSGPESSQTLPPDSTATDITGLQPGTT
YQVAVSVLRGREEGPAAVIVARTDPLGPVRTVHVTQASSSSVTITWTRVPGATGYRVSWH
SAHGPEKSQLVSGEATVAELDGLEPDTEYTVHVRAHVAGVDGPPASVVVRTAPEPVGRVS
RLQILNASSDVLRITWVGVTGATAYRLAWGRSEGGPMRHQILPGNTDSAEIRGLEGGVSY
SVRVTALVGDREGTPVSIVVTTPPEAPPALGTLHVVQRGEHSLRLRWEPVPRAQGFLLHW
QPEGGQEQSRVLGPELSSYHLDGLEPATQYRVRLSVLGPAGEGPSAEVTARTESPRVPSI
ELRVVDTSIDSVTLAWTPVSRASSYILSWRPLRGPGQEVPGSPQTLPGISSSQRVTGLEP
GVSYIFSLTPVLDGVRGPEASVTQTPVCPRGLADVVFLPHATQDNAHRAEATRRVLERLV
LALGPLGPQAVQVGLLSYSHRPSPLFPLNGSHDLGIILQRIRDMPYMDPSGNNLGTAVVT
AHRYMLAPDAPGRRQHVPGVMVLLVDEPLRGDIFSPIREAQASGLNVVMLGMAGADPEQL
RRLAPGMDSVQTFFAVDDGPSLDQAVSGLATALCQASFTTQPRPEPCPVYCPKGQKGEPG
EMGLRGQVGPPGDPGLPGRTGAPGPQGPPGSATAKGERGFPGADGRPGSPGRAGNPGTPG
APGLKGSPGLPGPRGDPGERGPRGPKGEPGAPGQVIGGEGPGLPGRKGDPGPSGPPGPRG
PLGDPGPRGPPGLPGTAMKG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05707	0.138	0.108	2.061E-80	1796	0.277	0.216	Q05707.pdb.gz	COEA1_HUMAN Collagen alpha-1(XIV) chain OS=Homo sapiens OX=9606 GN=COL14A1 PE=1 SV=3
2	AFDB:Q9UQP3	0.145	0.153	1.573E-62	1299	0.138	0.149	Q9UQP3.pdb.gz	TENN_HUMAN Tenascin-N OS=Homo sapiens OX=9606 GN=TNN PE=1 SV=2
3	AFDB:Q8BYI9	0.146	0.149	1.018E-61	1358	0.122	0.126	Q8BYI9.pdb.gz	TENR_MOUSE Tenascin-R OS=Mus musculus OX=10090 GN=Tnr PE=1 SV=2
4	AFDB:A2CF37	0.143	0.147	2.654E-61	1350	0.129	0.133	A2CF37.pdb.gz
5	AFDB:P24821	0.130	0.100	2.844E-60	2201	0.129	0.082	P24821.pdb.gz	TENA_HUMAN Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3
6	AFDB:B0S602	0.166	0.112	3.850E-60	2480	0.141	0.080	B0S602.pdb.gz	B0S602_DANRE Fibronectin OS=Danio rerio OX=7955 GN=Fn PE=1 SV=1
7	AFDB:Q80Z71	0.166	0.160	5.481E-60	1560	0.138	0.124	Q80Z71.pdb.gz	TENN_MOUSE Tenascin-N OS=Mus musculus OX=10090 GN=Tnn PE=1 SV=2
8	AFDB:Q9P218	0.141	0.154	6.177E-59	1284	0.228	0.248	Q9P218.pdb.gz	COKA1_HUMAN Collagen alpha-1(XX) chain OS=Homo sapiens OX=9606 GN=COL20A1 PE=1 SV=4
9	AFDB:P11722	0.167	0.113	1.611E-58	2483	0.151	0.085	P11722.pdb.gz	FINC_CHICK Fibronectin OS=Gallus gallus OX=9031 GN=FN1 PE=2 SV=4
10	AFDB:P07589	0.208	0.138	3.435E-58	2478	0.141	0.079	P07589.pdb.gz	FINC_BOVIN Fibronectin OS=Bos taurus OX=9913 GN=FN1 PE=1 SV=4
11	PDB:5a42A	0.111	0.102	3.216E-20	1597	0.096	0.085	5a42A.pdb.gz
12	PDB:5oj2B	0.116	0.181	7.484E-18	692	0.076	0.153	5oj2B.pdb.gz
13	PDB:6h03A	0.116	0.130	1.353E-15	1223	0.064	0.073	6h03A.pdb.gz
14	PDB:1e07A	0.089	0.165	1.832E-15	642	0.062	0.136	1e07A.pdb.gz
15	PDB:4nenA	0.115	0.149	4.543E-15	1063	0.086	0.113	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
16	PDB:7q1yA	0.110	0.111	7.914E-15	1374	0.069	0.071	7q1yA.pdb.gz
17	PDB:4ziqA	0.092	0.089	1.127E-14	1450	0.072	0.070	4ziqA.pdb.gz
18	PDB:7q5zA	0.113	0.117	1.774E-14	1344	0.054	0.056	7q5zA.pdb.gz
19	PDB:7nycA	0.113	0.104	3.978E-14	1542	0.067	0.061	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:4nehA	0.117	0.150	4.401E-14	1084	0.079	0.102	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SKM1	0.0	2279	2938	0.855	0.407	F1SKM1_PIG Collagen type VII alpha 1 chain OS=Sus scrofa OX=9823 GN=COL7A1 PE=4 SV=2
2	Q02388	0.0	2743	2944	1.000	0.476	CO7A1_HUMAN Collagen alpha-1(VII) chain OS=Homo sapiens OX=9606 GN=COL7A1 PE=1 SV=2
3	Q63870	0.0	2083	2944	0.796	0.378	CO7A1_MOUSE Collagen alpha-1(VII) chain OS=Mus musculus OX=10090 GN=Col7a1 PE=1 SV=3
4	F1S285	1.37e-89	323	1760	0.198	0.157	F1S285_PIG Collagen type XIV alpha 1 chain OS=Sus scrofa OX=9823 GN=COL14A1 PE=1 SV=3
5	Q99715	4.49e-89	323	3063	0.222	0.102	COCA1_HUMAN Collagen alpha-1(XII) chain OS=Homo sapiens OX=9606 GN=COL12A1 PE=1 SV=2
6	Q60847	3.33e-87	317	3120	0.219	0.098	COCA1_MOUSE Collagen alpha-1(XII) chain OS=Mus musculus OX=10090 GN=Col12a1 PE=2 SV=3
7	Q05707	3.92e-86	313	1796	0.192	0.150	COEA1_HUMAN Collagen alpha-1(XIV) chain OS=Homo sapiens OX=9606 GN=COL14A1 PE=1 SV=3
8	Q80X19	2.22e-83	304	1797	0.186	0.145	COEA1_MOUSE Collagen alpha-1(XIV) chain OS=Mus musculus OX=10090 GN=Col14a1 PE=1 SV=2
9	F1R9Y1	5.02e-83	303	1864	0.184	0.138	F1R9Y1_DANRE Collagen alpha-1(XIV) chain isoform X2 OS=Danio rerio OX=7955 GN=col14a1a PE=1 SV=1
10	Q9P218	5.98e-61	232	1284	0.164	0.178	COKA1_HUMAN Collagen alpha-1(XX) chain OS=Homo sapiens OX=9606 GN=COL20A1 PE=1 SV=4
11	Q80Z71	2.17e-47	189	1560	0.149	0.134	TENN_MOUSE Tenascin-N OS=Mus musculus OX=10090 GN=Tnn PE=1 SV=2
12	P02751	8.92e-46	184	2477	0.161	0.091	FINC_HUMAN Fibronectin OS=Homo sapiens OX=9606 GN=FN1 PE=1 SV=5
13	P04937	1.03e-44	181	2477	0.161	0.091	FINC_RAT Fibronectin OS=Rattus norvegicus OX=10116 GN=Fn1 PE=1 SV=2
14	E9Q2T3	2.44e-44	179	3126	0.170	0.076	E9Q2T3_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
15	Q3V5L4	3.10e-44	179	3126	0.170	0.076	Q3V5L4_MOUSE Tenascin-X OS=Mus musculus OX=10090 GN=Tnxb PE=2 SV=1
16	Q7T3T6	4.63e-44	177	1350	0.154	0.160	Q7T3T6_DANRE Tenascin-R OS=Danio rerio OX=7955 GN=tnr PE=1 SV=1
17	P11276	3.32e-43	176	2477	0.157	0.089	FINC_MOUSE Fibronectin OS=Mus musculus OX=10090 GN=Fn1 PE=1 SV=4
18	P07589	5.25e-43	175	2478	0.161	0.091	FINC_BOVIN Fibronectin OS=Bos taurus OX=9913 GN=FN1 PE=1 SV=4
19	F1SS24	1.98e-42	173	2462	0.178	0.101	F1SS24_PIG Fibronectin OS=Sus scrofa OX=9823 GN=FN1 PE=1 SV=2
20	B0S602	5.45e-42	172	2480	0.139	0.079	B0S602_DANRE Fibronectin OS=Danio rerio OX=7955 GN=Fn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17425 Arylsulfotran_N	0.39	22.1	Arylsulfotransferase Ig-like domain
2	PF01391 Collagen	2.9e-16	70.3	Collagen triple helix repeat (20 copies)
3	PF16383 DUF4992	4.9e-08	44.3	Domain of unknown function
4	PF16389 DUF4998	1	20.4	Domain of unknown function
5	PF00041 fn3	2.5e-95	324.3	Fibronectin type III domain
6	PF16893 fn3_2	1	20.9	Fibronectin type III domain
7	PF16874 Glyco_hydro_36C	0.00028	32.6	Glycosyl hydrolase family 36 C-terminal domain
8	PF09294 Interfer-bind	3.5e-07	41.8	Interferon-alpha/beta receptor, fibronectin type III
9	PF19433 NDNF_C	26	15.8	Neuron-derived Neurotrophic Factor C-terminal
10	PF16656 Pur_ac_phosph_N	6.3e-17	73.3	Purple acid Phosphatase, N-terminal domain
11	PF00092 VWA	2e-62	222.0	von Willebrand factor type A domain
12	PF13519 VWA_2	1.1e-16	72.8	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332371

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340900	0.951	Transport and Golgi organization protein 1 homolog
2	9606.ENSP00000305714	0.946	Bone morphogenetic protein 1
3	9606.ENSP00000452786	0.936	Integrin beta-3
4	9606.ENSP00000379350	0.934	Integrin beta-1
5	9606.ENSP00000261023	0.928	Integrin alpha-V
6	9606.ENSP00000264144	0.925	Laminin subunit gamma-2
7	9606.ENSP00000375778	0.919	Laminin subunit beta-3
8	9606.ENSP00000384999	0.915	Prolyl 4-hydroxylase subunit alpha-2
9	9606.ENSP00000296585	0.912	Integrin alpha-2
10	9606.ENSP00000061240	0.907	Tolloid-like protein 1
11	9606.ENSP00000263556	0.907	Prolyl 4-hydroxylase subunit alpha-1
12	9606.ENSP00000370542	0.907	Syndecan-1
13	9606.ENSP00000350630	0.905	Tolloid-like protein 2
14	9606.ENSP00000401749	0.903	Prolyl 4-hydroxylase subunit alpha-3
15	9606.ENSP00000390783	0.902	Sec1 family domain-containing protein 1
16	9606.ENSP00000222547	0.900	BET1 homolog
17	9606.ENSP00000259400	0.900	Syntaxin-17
18	9606.ENSP00000351273	0.900	Caspase-8
19	9606.ENSP00000324532	0.899	Laminin subunit alpha-3
20	9606.ENSP00000325146	0.847	Collagen alpha-1(XII) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	0.998	extracellular matrix structural constituent
GO:0030020	0.816	extracellular matrix structural constituent conferring tensile strength

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.945	developmental process
GO:0032501	0.940	multicellular organismal process
GO:0048856	0.940	anatomical structure development
GO:0007275	0.904	multicellular organism development
GO:0009987	0.903	cellular process
GO:0001704	0.865	formation of primary germ layer
GO:0007492	0.859	endoderm development
GO:0001706	0.833	endoderm formation
GO:0008544	0.808	epidermis development
GO:0035987	0.671	endodermal cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.997	cell periphery
GO:0031012	0.971	extracellular matrix
GO:0062023	0.962	collagen-containing extracellular matrix
GO:0005576	0.946	extracellular region
GO:0012505	0.634	endomembrane system
GO:0031982	0.592	vesicle
GO:0016020	0.590	membrane
GO:0005604	0.584	basement membrane
GO:0043231	0.548	intracellular membrane-bounded organelle
GO:0005737	0.528	cytoplasm
GO:0032991	0.358	protein-containing complex
GO:0031090	0.331	organelle membrane
GO:0098588	0.314	bounding membrane of organelle
GO:0005783	0.313	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]