StarFunc result for job id Q02410

User Input

>input (837 residues)
MNHLEGSAEVEVTDEAAGGEVNESVEADLEHPEVEEEQQQPPQQQHYVGRHQRGRALEDL
RAQLGQEEEERGECLARSASTESGFHNHTDTAEGDVIAAARDGYDAERAQDPEDESAYAV
QYRPEAEEYTEQAEAEHAEATHRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGED
EPYSEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDEAAAYRQEALGARLHHYDE
RSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQDL
ERPPTPAGGRPDSPGLQAPAGQQRAVGPAGGGEAGQRYSKEKRDAISLAIKDIKEAIEEV
KTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPMDGDSPSPGSSSPLGAESSSTSLH
PSDPVEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPSKN
VRMMQAQEAVSRIKMAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQETMMDH
PLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDGKRQYKMICHVFESEDAQLI
AQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVFIE
KQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLPLS
TCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAERG
GVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RUJ5	0.524	0.521	0.000	842	0.937	0.931	B2RUJ5.pdb.gz	APBA1_MOUSE Amyloid-beta A4 precursor protein-binding family A member 1 OS=Mus musculus OX=10090 GN=Apba1 PE=1 SV=2
2	AFDB:X2JE74	0.406	0.297	3.002E-58	1170	0.367	0.262	X2JE74.pdb.gz	X2JE74_DROME X11L, isoform F OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=1
3	AFDB:Q9W2S5	0.314	0.138	2.089E-56	2139	0.354	0.138	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
4	PDB:2xkxA	0.095	0.110	3.136E-9	721	0.056	0.065	2xkxA.pdb.gz
5	PDB:6pcvA	0.103	0.112	2.690E-6	754	0.039	0.044	6pcvA.pdb.gz
6	PDB:5n7dA	0.095	0.178	2.966E-5	423	0.030	0.059	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
7	PDB:7pc3A	0.090	0.179	4.901E-5	405	0.023	0.047	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
8	AFDB:E9Q9R9	0.096	0.047	9.032E-5	1921	0.145	0.063	E9Q9R9.pdb.gz	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
9	PDB:3pv2B	0.076	0.159	9.057E-5	388	0.032	0.070	3pv2B.pdb.gz
10	PDB:7p73A	0.092	0.179	1.132E-4	420	0.024	0.048	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
11	AFDB:Q9VKG8	0.101	0.047	1.412E-4	1916	0.130	0.057	Q9VKG8.pdb.gz	Q9VKG8_DROME Discs large 5, isoform A OS=Drosophila melanogaster OX=7227 GN=Dlg5 PE=1 SV=1
12	AFDB:B1Q240	0.106	0.098	1.765E-4	915	0.115	0.105	B1Q240.pdb.gz	B1Q240_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=2
13	AFDB:P91621	0.126	0.058	2.087E-4	2072	0.116	0.047	P91621.pdb.gz	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
14	PDB:7pcbA	0.095	0.187	2.092E-4	415	0.024	0.048	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:7p70A	0.098	0.194	3.270E-4	407	0.025	0.052	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
16	AFDB:Q9W283	0.114	0.074	3.448E-4	1329	0.118	0.074	Q9W283.pdb.gz	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
17	AFDB:Q93203	0.145	0.105	4.311E-4	1170	0.119	0.085	Q93203.pdb.gz	Q93203_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C11E4.6 PE=1 SV=2
18	AFDB:M0R9T2	0.093	0.064	5.389E-4	1258	0.153	0.102	M0R9T2.pdb.gz	M0R9T2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=3
19	PDB:7pc5A	0.093	0.187	6.756E-4	405	0.026	0.054	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7qqnC	0.086	0.170	7.554E-4	414	0.029	0.058	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RUJ5	0.0	1548	842	0.935	0.930	APBA1_MOUSE Amyloid-beta A4 precursor protein-binding family A member 1 OS=Mus musculus OX=10090 GN=Apba1 PE=1 SV=2
2	O35430	0.0	1522	839	0.935	0.933	APBA1_RAT Amyloid-beta A4 precursor protein-binding family A member 1 OS=Rattus norvegicus OX=10116 GN=Apba1 PE=1 SV=1
3	O35431	0.0	724	750	0.450	0.503	APBA2_RAT Amyloid-beta A4 precursor protein-binding family A member 2 OS=Rattus norvegicus OX=10116 GN=Apba2 PE=1 SV=1
4	P98084	0.0	722	750	0.502	0.560	APBA2_MOUSE Amyloid-beta A4 precursor protein-binding family A member 2 OS=Mus musculus OX=10090 GN=Apba2 PE=1 SV=2
5	Q02410	0.0	1725	837	1.000	1.000	APBA1_HUMAN Amyloid-beta A4 precursor protein-binding family A member 1 OS=Homo sapiens OX=9606 GN=APBA1 PE=1 SV=3
6	Q99767	0.0	704	749	0.404	0.451	APBA2_HUMAN Amyloid-beta A4 precursor protein-binding family A member 2 OS=Homo sapiens OX=9606 GN=APBA2 PE=1 SV=3
7	O96018	1.02e-171	510	575	0.297	0.433	APBA3_HUMAN Amyloid-beta A4 precursor protein-binding family A member 3 OS=Homo sapiens OX=9606 GN=APBA3 PE=1 SV=1
8	O70248	1.77e-167	499	569	0.299	0.439	APBA3_RAT Amyloid-beta A4 precursor protein-binding family A member 3 OS=Rattus norvegicus OX=10116 GN=Apba3 PE=1 SV=2
9	O88888	6.93e-163	487	571	0.278	0.408	APBA3_MOUSE Amyloid-beta A4 precursor protein-binding family A member 3 OS=Mus musculus OX=10090 GN=Apba3 PE=1 SV=1
10	Q5BI79	2.60e-154	493	1603	0.292	0.152	Q5BI79_DROME LP19469p (Fragment) OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=2 SV=1
11	Q9VX41	4.56e-152	478	1167	0.308	0.221	Q9VX41_DROME LD29081p OS=Drosophila melanogaster OX=7227 GN=X11L PE=1 SV=2
12	E1JJN6	4.81e-152	478	1168	0.308	0.221	E1JJN6_DROME X11L, isoform B OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=1
13	Q9GQQ6	4.91e-152	478	1168	0.296	0.212	Q9GQQ6_DROME DX11 OS=Drosophila melanogaster OX=7227 GN=X11L PE=1 SV=1
14	X2JE74	5.30e-152	478	1170	0.308	0.221	X2JE74_DROME X11L, isoform F OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=1
15	M9PGU7	6.05e-152	493	2066	0.292	0.118	M9PGU7_DROME X11Lbeta, isoform D OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=4 SV=2
16	X2JB44	6.43e-152	493	2129	0.292	0.115	X2JB44_DROME X11Lbeta, isoform E OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=4 SV=1
17	Q9W2S5	1.28e-151	493	2139	0.292	0.114	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
18	O17583	3.51e-151	470	982	0.283	0.241	LIN10_CAEEL Protein lin-10 OS=Caenorhabditis elegans OX=6239 GN=lin-10 PE=1 SV=1
19	M9PF12	4.45e-151	475	1162	0.295	0.213	M9PF12_DROME X11L, isoform E OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=2
20	F1QFG9	1.61e-12	71.6	307	0.049	0.134	F1QFG9_DANRE Syndecan-binding protein (syntenin) OS=Danio rerio OX=7955 GN=sb:eu862 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00595 PDZ	3.1e-24	96.4	PDZ domain
2	PF13180 PDZ_2	0.11	24.2	PDZ domain
3	PF17820 PDZ_6	3.4e-12	57.4	PDZ domain
4	PF02163 Peptidase_M50	1.3	19.8	Peptidase family M50
5	PF00640 PID	2.3e-48	175.2	Phosphotyrosine interaction domain (PTB/PID)
6	PF18995 PRT6_C	3.9e+02	11.3	Proteolysis_6 C-terminal
7	PF10428 SOG2	3.5e+02	11.8	RAM signalling pathway protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265381

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284981	0.999	Amyloid-beta A4 protein
2	9606.ENSP00000367408	0.999	Peripheral plasma membrane protein CASK
3	9606.ENSP00000247986	0.996	Kinesin-like protein KIF17
4	9606.ENSP00000362399	0.992	Syntaxin-binding protein 1
5	9606.ENSP00000278193	0.987	Protein lin-7 homolog C
6	9606.ENSP00000221459	0.968	Protein lin-7 homolog B
7	9606.ENSP00000477455	0.968	Glutamate receptor ionotropic, NMDA 2B
8	9606.ENSP00000447488	0.966	Protein lin-7 homolog A
9	9606.ENSP00000450337	0.963	Liprin-alpha-2
10	9606.ENSP00000253925	0.962	Liprin-alpha-1
11	9606.ENSP00000254976	0.956	Synaptosomal-associated protein 25
12	9606.ENSP00000335614	0.955	Liprin-alpha-3
13	9606.ENSP00000428417	0.945	Regulating synaptic membrane exocytosis protein 1
14	9606.ENSP00000222256	0.942	Ras-related protein Rab-3A
15	9606.ENSP00000261205	0.930	Synaptotagmin-1
16	9606.ENSP00000298472	0.925	Synaptic vesicular amine transporter
17	9606.ENSP00000367756	0.925	Protein unc-13 homolog B
18	9606.ENSP00000345824	0.921	Benzodiazepine receptor (peripheral) associated protein 1
19	9606.ENSP00000272198	0.919	Liprin-alpha-4
20	9606.ENSP00000295987	0.918	Synapsin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0065007	0.988	biological regulation
GO:0007267	0.945	cell-cell signaling
GO:0051179	0.941	localization
GO:0098916	0.935	anterograde trans-synaptic signaling
GO:0007268	0.927	chemical synaptic transmission
GO:0051641	0.910	cellular localization
GO:0051234	0.907	establishment of localization
GO:0006810	0.903	transport
GO:0050789	0.899	regulation of biological process
GO:0050794	0.886	regulation of cellular process
GO:0032501	0.852	multicellular organismal process
GO:0051649	0.712	establishment of localization in cell
GO:0048856	0.686	anatomical structure development
GO:0046903	0.663	secretion
GO:0140352	0.431	export from cell
GO:0065008	0.417	regulation of biological quality
GO:0050896	0.413	response to stimulus
GO:0023051	0.409	regulation of signaling
GO:0010646	0.406	regulation of cell communication
GO:0007275	0.382	multicellular organism development
GO:0071840	0.334	cellular component organization or biogenesis
GO:0001505	0.309	regulation of neurotransmitter levels
GO:0016043	0.303	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0045202	0.998	synapse
GO:0005829	0.997	cytosol
GO:0043226	0.989	organelle
GO:0043227	0.977	membrane-bounded organelle
GO:0012505	0.973	endomembrane system
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0098793	0.896	presynapse
GO:0032991	0.895	protein-containing complex
GO:0031982	0.844	vesicle
GO:0031410	0.625	cytoplasmic vesicle
GO:0120025	0.487	plasma membrane bounded cell projection
GO:0043005	0.454	neuron projection
GO:0098590	0.425	plasma membrane region
GO:0048786	0.325	presynaptic active zone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]