StarFunc result for job id Q02413

User Input

>input (1049 residues)
MDWSFFRVVAMLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACRE
GEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVT
PFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILN
ATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYALAVRGS
DRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTIEIQENTLNSNLLEIRVIDLDEEFS
ANWMAVIFFISGNEGNWFEIEMNERTNVGILKVVKPLDYEAMQSLQLSIGVRNKAEFHHS
IMSQYKLKASAISVTVLNVIEGPVFRPGSKTYVVTGNMGSNDKVGDFVATDLDTGRPSTT
VRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTIN
INIQSFGNDDRTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLL
SDNVHFGPAGIGLLIMGFLVLGLVPFLMICCDCGGAPRSAAGFEPVPECSDGAIHSWAVE
GPQPEPRDITTVIPQIPPDNANIIECIDNSGVYTNEYGGREMQDLGGGERMTGFELTEGV
KTSGMPEICQEYSGTLRRNSMRECREGGLNMNFMESYFCQKAYAYADEDEGRPSNDCLLI
YDIEGVGSPAGSVGCCSFIGEDLDDSFLDTLGPKFKKLADISLGKESYPDLDPSWPPQST
EPVCLPQETEPVVSGHPPISPHFGTTTVISESTYPSGPGVLHPKPILDPLGYGNVTVTES
YTTSDTLKPSVHVHDNRPASNVVVTERVVGPISGADLHGMLEMPDLRDGSNVIVTERVIA
PSSSLPTSLTIHHPRESSNVVVTERVIQPTSGMIGSLSMHPELANAHNVIVTERVVSGAG
VTGISGTTGISGGIGSSGLVGTSMGAGSGALSGAGISGGGIGLSSLGGTASIGHMRSSSD
HHFNQTIGSASPSTARSRITKYSTVQYSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZM39	0.593	0.588	0.000	1060	0.786	0.778	D3ZM39.pdb.gz	D3ZM39_RAT Desmoglein 1 OS=Rattus norvegicus OX=10116 GN=Dsg1 PE=4 SV=1
2	AFDB:Q02413	0.999	0.999	0.000	1049	1.000	1.000	Q02413.pdb.gz	DSG1_HUMAN Desmoglein-1 OS=Homo sapiens OX=9606 GN=DSG1 PE=1 SV=2
3	AFDB:Q03763	0.521	0.524	0.000	1043	0.794	0.799	Q03763.pdb.gz	DSG1_BOVIN Desmoglein-1 OS=Bos taurus OX=9913 GN=DSG1 PE=1 SV=1
4	AFDB:Q7TSF0	0.452	0.518	0.000	911	0.700	0.806	Q7TSF0.pdb.gz	DSG1C_MOUSE Desmoglein-1-gamma OS=Mus musculus OX=10090 GN=Dsg1c PE=1 SV=1
5	AFDB:Q7TSF1	0.450	0.446	0.000	1060	0.772	0.764	Q7TSF1.pdb.gz	DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus OX=10090 GN=Dsg1b PE=1 SV=1
6	AFDB:Q86SJ6	0.449	0.452	5.382E-87	1040	0.427	0.431	Q86SJ6.pdb.gz	DSG4_HUMAN Desmoglein-4 OS=Homo sapiens OX=9606 GN=DSG4 PE=1 SV=1
7	AFDB:Q7TMD7	0.439	0.442	4.277E-86	1041	0.445	0.449	Q7TMD7.pdb.gz	DSG4_MOUSE Desmoglein-4 OS=Mus musculus OX=10090 GN=Dsg4 PE=1 SV=1
8	AFDB:O55111	0.400	0.375	1.974E-63	1122	0.334	0.312	O55111.pdb.gz	DSG2_MOUSE Desmoglein-2 OS=Mus musculus OX=10090 GN=Dsg2 PE=1 SV=3
9	AFDB:Q02487	0.410	0.472	5.474E-53	901	0.199	0.232	Q02487.pdb.gz	DSC2_HUMAN Desmocollin-2 OS=Homo sapiens OX=9606 GN=DSC2 PE=1 SV=1
10	AFDB:P55292	0.401	0.463	1.321E-52	902	0.201	0.234	P55292.pdb.gz	DSC2_MOUSE Desmocollin-2 OS=Mus musculus OX=10090 GN=Dsc2 PE=1 SV=1
11	PDB:6velC	0.189	0.892	3.399E-20	209	0.074	0.373	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
12	PDB:7sqcO0	0.134	0.126	4.208E-11	1140	0.048	0.044	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
13	PDB:4aq1A	0.102	0.135	8.692E-11	721	0.056	0.082	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:5oj2B	0.122	0.164	3.935E-8	692	0.051	0.078	5oj2B.pdb.gz
15	PDB:6dldD	0.109	0.272	7.547E-7	269	0.039	0.152	6dldD.pdb.gz
16	PDB:7sqcO1	0.133	0.177	2.618E-6	673	0.038	0.059	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:6dlfA	0.108	0.322	2.839E-5	236	0.038	0.169	6dlfA.pdb.gz
18	PDB:5a42A	0.076	0.058	2.990E-5	1597	0.057	0.038	5a42A.pdb.gz
19	PDB:7q1yA	0.114	0.092	5.021E-5	1374	0.049	0.037	7q1yA.pdb.gz
20	PDB:7uslA	0.099	0.114	5.021E-5	856	0.038	0.047	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZM39	0.0	1595	1060	0.785	0.776	D3ZM39_RAT Desmoglein 1 OS=Rattus norvegicus OX=10116 GN=Dsg1 PE=4 SV=1
2	P32926	0.0	560	999	0.254	0.266	DSG3_HUMAN Desmoglein-3 OS=Homo sapiens OX=9606 GN=DSG3 PE=1 SV=2
3	Q02413	0.0	2165	1049	1.000	1.000	DSG1_HUMAN Desmoglein-1 OS=Homo sapiens OX=9606 GN=DSG1 PE=1 SV=2
4	Q03763	0.0	1649	1043	0.796	0.801	DSG1_BOVIN Desmoglein-1 OS=Bos taurus OX=9913 GN=DSG1 PE=1 SV=1
5	Q61495	0.0	1639	1057	0.797	0.791	DSG1A_MOUSE Desmoglein-1-alpha OS=Mus musculus OX=10090 GN=Dsg1a PE=2 SV=2
6	Q6W3B0	0.0	619	1040	0.271	0.273	DSG4_RAT Desmoglein-4 OS=Rattus norvegicus OX=10116 GN=Dsg4 PE=1 SV=1
7	Q7TMD7	0.0	617	1041	0.272	0.274	DSG4_MOUSE Desmoglein-4 OS=Mus musculus OX=10090 GN=Dsg4 PE=1 SV=1
8	Q7TSF0	0.0	1449	911	0.697	0.802	DSG1C_MOUSE Desmoglein-1-gamma OS=Mus musculus OX=10090 GN=Dsg1c PE=1 SV=1
9	Q7TSF1	0.0	1639	1060	0.798	0.790	DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus OX=10090 GN=Dsg1b PE=1 SV=1
10	Q86SJ6	0.0	621	1040	0.274	0.276	DSG4_HUMAN Desmoglein-4 OS=Homo sapiens OX=9606 GN=DSG4 PE=1 SV=1
11	O35902	6.77e-178	547	993	0.246	0.260	DSG3_MOUSE Desmoglein-3 OS=Mus musculus OX=10090 GN=Dsg3 PE=2 SV=1
12	Q14126	4.21e-163	512	1118	0.375	0.352	DSG2_HUMAN Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2
13	A0A8I6AG90	4.00e-155	491	1131	0.367	0.340	A0A8I6AG90_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=1
14	F1LYX9	5.38e-155	491	1128	0.371	0.345	F1LYX9_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=2
15	O55111	3.47e-117	390	1122	0.195	0.183	DSG2_MOUSE Desmoglein-2 OS=Mus musculus OX=10090 GN=Dsg2 PE=1 SV=3
16	H2EQR6	1.10e-83	296	1142	0.248	0.228	DSG21_DANRE Desmoglein-2.1 OS=Danio rerio OX=7955 GN=dsg2.1 PE=2 SV=1
17	P55292	9.96e-75	267	902	0.209	0.243	DSC2_MOUSE Desmocollin-2 OS=Mus musculus OX=10090 GN=Dsc2 PE=1 SV=1
18	P55850	2.58e-68	249	896	0.138	0.162	DSC3_MOUSE Desmocollin-3 OS=Mus musculus OX=10090 GN=Dsc3 PE=1 SV=3
19	Q14574	1.18e-67	247	896	0.137	0.161	DSC3_HUMAN Desmocollin-3 OS=Homo sapiens OX=9606 GN=DSC3 PE=1 SV=3
20	Q02487	7.73e-66	241	901	0.143	0.166	DSC2_HUMAN Desmocollin-2 OS=Homo sapiens OX=9606 GN=DSC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	3.9e-53	189.2	Cadherin domain
2	PF08266 Cadherin_2	4.6	18.5	Cadherin-like
3	PF16184 Cadherin_3	0.19	23.0	Cadherin-like
4	PF01049 CADH_Y-type_LIR	3.4e-06	38.4	Cadherin, Y-type LIR-motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257192

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263946	0.993	Plakophilin-1
2	9606.ENSP00000369129	0.983	Desmoplakin
3	9606.ENSP00000070846	0.981	Plakophilin-2
4	9606.ENSP00000426632	0.964	Erbin
5	9606.ENSP00000377508	0.962	Junction plakoglobin
6	9606.ENSP00000331678	0.937	Plakophilin-3
7	9606.ENSP00000311032	0.919	Caspase-3
8	9606.ENSP00000365465	0.917	Corneodesmosin
9	9606.ENSP00000344456	0.907	Catenin beta-1
10	9606.ENSP00000357789	0.872	Filaggrin
11	9606.ENSP00000257198	0.865	Desmocollin-1
12	9606.ENSP00000382004	0.853	Catenin delta-1
13	9606.ENSP00000301607	0.827	Envoplakin
14	9606.ENSP00000374409	0.814	Plakophilin-4
15	9606.ENSP00000340937	0.805	Collagen alpha-1(XVII) chain
16	9606.ENSP00000340510	0.795	Periplakin
17	9606.ENSP00000280904	0.788	Desmocollin-2
18	9606.ENSP00000397157	0.775	P53 apoptosis effector related to PMP-22
19	9606.ENSP00000307959	0.767	Dystonin
20	9606.ENSP00000353608	0.739	Desmocollin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0045295	0.575	gamma-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.967	biological regulation
GO:0009987	0.752	cellular process
GO:0065008	0.724	regulation of biological quality
GO:0031647	0.692	regulation of protein stability
GO:0050789	0.674	regulation of biological process
GO:0032501	0.508	multicellular organismal process
GO:0050896	0.472	response to stimulus
GO:0050821	0.455	protein stabilization
GO:0050794	0.446	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005911	0.998	cell-cell junction
GO:0016020	0.992	membrane
GO:0071944	0.976	cell periphery
GO:0005886	0.971	plasma membrane
GO:0030057	0.927	desmosome
GO:0043227	0.786	membrane-bounded organelle
GO:0005737	0.778	cytoplasm
GO:0005576	0.767	extracellular region
GO:0043231	0.648	intracellular membrane-bounded organelle
GO:0031982	0.341	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]