StarFunc result for job id Q02505

User Input

>input (1400 residues)
MQLLGLLGLLWMLKASPWATGTLSTATSISQVPFPRAEAASAVLSNSPHSRDLAGWPLGV
PQLASPAPGHRENAPMTLTTSPHDTLISETLLNSPVSSNTSTTPTSKFAFKVETTPPTVL
VYSATTECVYPTSFIITISHPTSICVTTTQVAFTSSYTSTPVTQKPVTTVTSTYSMTTTE
KGTSAMTSSPSTTTARETPIVTVTPSSVSATDTTFHTTISSTTRTTERTPLPTGSIHTTT
SPTPVFTTLKTAVTSTSPITSSITSTNTVTSMTTTASQPTATNTLSSPTRTILSSTPVLS
TETITSGITNTTPLSTLVTTLPTTISRSTPTSETTYTTSPTSTVTDSTTKIAYSTSMTGT
LSTETSLPPTSSSLPTTETATTPMTNLVTTTTEISSHSTPSFSSSTIYSTVSTSTTAISS
LPPTSGTMVTSTTMTPSSLSTDIPFTTPTTITHHSVGSTGFLTTATDLTSTFTVSSSSAM
STSVIPSSPSIQNTETSSLVSMTSATTPNVRPTFVSTLSTPTSSLLTTFPATYSFSSSMS
ASSAGTTHTESISSPPASTSTLHTTAESTLAPTTTTSFTTSTTMEPPSTTAATTGTGQTT
FTSSTATFPETTTPTPTTDMSTESLTTAMTSPPITSSVTSTNTVTSMTTTTSPPTTTNSF
TSLTSMPLSSTPVPSTEVVTSGTINTIPPSILVTTLPTPNASSMTTSETTYPNSPTGPGT
NSTTEITYPTTMTETSSTATSLPPTSPLVSTAKTAKTPTTNLVTTTTKTTSHSTTSFTSS
TVYSTASTYTTAITSVPTTLGTMVTSTSMISSTVSTGIPTSQPTTITPSSVGISGSLPMM
TDLTSVYTVSNMSARPTTVIPSSPTVQNTEISISVSMTSATTPSGGPTFTSTENTPTRSL
LTSFPMTHSFSSSMSESSAGTTHTESISSPRGTTSTLHTTVESTPSPTTTTSFTTSTMME
PPSSTVSTTGRGQTTFPSSTATFPETTTLTPTTDISTVSLTTAMTSPPPVSSSITPTNTM
TSMRTTTYWPTATNTLSPLTSSILSSTPVPSTEMITSHTTNTTPLSTLVTTLLTTITRST
PTSETTYPTSPTSIVSDSTTEITYSTSITGTLSTATTLPPTSSSLPTTETATMTPTTTLI
TTTPNTTSLSTPSFTSSTIYSTVSTSTTAISSASPTSGTMVTSTTMTPSSLSTDTPSTTP
TTITYPSVGSTGFLTTATDLTSTFTVSSSSAMSTSVIPSSPSIQNTETSSLVSMTSATTP
SLRPTITSTDSTLTSSLLTTFPSTYSFSSSMSASSAGTTHTETISSLPASTNTIHTTAES
ALAPTTTTSFTTSPTMEPPSTTVATTGTGQTTFPSSTATFLETTTLTPTTDFSTESLTTA
MTSTPPITSSITPTDTMTSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H195	0.045	0.050	2.548E-42	1237	0.344	0.390	Q9H195.pdb.gz	MUC3B_HUMAN Mucin-3B OS=Homo sapiens OX=9606 GN=MUC3B PE=2 SV=3
2	AFDB:Q8CGM2	0.036	0.031	1.900E-3	1859	0.152	0.115	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
3	AFDB:A2CG63	0.034	0.033	2.637E-2	1314	0.069	0.073	A2CG63.pdb.gz	ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus OX=10090 GN=Arid4b PE=1 SV=1
4	AFDB:Q3TUF7	0.036	0.036	3.108E-2	1407	0.112	0.112	Q3TUF7.pdb.gz	YETS2_MOUSE YEATS domain-containing protein 2 OS=Mus musculus OX=10090 GN=Yeats2 PE=1 SV=2
5	PDB:2k8pA	0.028	0.121	3.161E-2	189	0.012	0.090	2k8pA.pdb.gz
6	AFDB:P21519	0.036	0.033	8.333E-2	1594	0.099	0.087	P21519.pdb.gz	MAM_DROME Neurogenic protein mastermind OS=Drosophila melanogaster OX=7227 GN=mam PE=2 SV=2
7	AFDB:Q9QZS0	0.030	0.028	9.047E-2	1669	0.128	0.107	Q9QZS0.pdb.gz	CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus OX=10090 GN=Col4a3 PE=1 SV=2
8	AFDB:O74346	0.030	0.042	1.746E-1	948	0.119	0.175	O74346.pdb.gz	MAP4_SCHPO P cell-type agglutination protein map4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=map4 PE=3 SV=1
9	AFDB:A2A7B5	0.034	0.030	2.234E-1	1709	0.157	0.129	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
10	AFDB:Q01955	0.032	0.029	2.426E-1	1670	0.127	0.107	Q01955.pdb.gz	CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens OX=9606 GN=COL4A3 PE=1 SV=3
11	AFDB:Q09JY9	0.041	0.036	3.370E-1	1726	0.141	0.115	Q09JY9.pdb.gz	SHRM2_XENTR Protein Shroom2 OS=Xenopus tropicalis OX=8364 GN=shroom2 PE=2 SV=1
12	PDB:1sxjH	0.022	0.103	6.615E-1	267	0.004	0.019	1sxjH.pdb.gz	Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
13	PDB:4v96Bd	0.018	0.099	1.176	165	0.006	0.055	4v96Bd.pdb.gz
14	PDB:2wzpA	0.021	0.085	1.386	266	0.006	0.030	2wzpA.pdb.gz
15	PDB:7t9iB	0.025	0.192	1.386	109	0.005	0.064	7t9iB.pdb.gz
16	PDB:6ue8D	0.018	0.135	1.774	132	0.002	0.023	6ue8D.pdb.gz
17	PDB:3a2fB	0.023	0.107	2.270	247	0.006	0.032	3a2fB.pdb.gz
18	PDB:5hk5F	0.023	0.131	2.270	129	0.006	0.070	5hk5F.pdb.gz
19	PDB:5hz9A	0.020	0.149	2.270	135	0.006	0.067	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
20	PDB:2z4hB	0.024	0.093	2.464	194	0.006	0.041	2z4hB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q02505	0.0	2430	3323	1.000	0.421	MUC3A_HUMAN Mucin-3A OS=Homo sapiens OX=9606 GN=MUC3A PE=1 SV=3
2	Q9H195	2.23e-119	405	1237	0.211	0.239	MUC3B_HUMAN Mucin-3B OS=Homo sapiens OX=9606 GN=MUC3B PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368771

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000485028	0.975	Mucin-13
2	9606.ENSP00000416753	0.974	Mucin-15
3	9606.ENSP00000406861	0.972	Mucin-6
4	9606.ENSP00000407422	0.972	Mucin-7
5	9606.ENSP00000414350	0.972	Mucin-20
6	9606.ENSP00000376570	0.971	Polypeptide N-acetylgalactosaminyltransferase 13
7	9606.ENSP00000436812	0.971	Mucin-5B
8	9606.ENSP00000365473	0.969	Mucin-21
9	9606.ENSP00000381008	0.968	Mucin-16
10	9606.ENSP00000484824	0.968	Mucin-1
11	9606.ENSP00000485659	0.968	Mucin-5AC
12	9606.ENSP00000269195	0.962	Polypeptide N-acetylgalactosaminyltransferase 1
13	9606.ENSP00000302716	0.942	Mucin-17
14	9606.ENSP00000441929	0.942	Mucin-12
15	9606.ENSP00000417498	0.940	Mucin-4
16	9606.ENSP00000317027	0.926	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4
17	9606.ENSP00000236709	0.925	Alpha-1,4-N-acetylglucosaminyltransferase
18	9606.ENSP00000321874	0.918	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
19	9606.ENSP00000379377	0.918	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
20	9606.ENSP00000287590	0.916	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.806	cellular process
GO:0065007	0.305	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005796	1.000	Golgi lumen
GO:0005615	0.426	extracellular space
GO:0043230	0.418	extracellular organelle
GO:0009986	0.412	cell surface
GO:0070062	0.388	extracellular exosome
GO:0098552	0.385	side of membrane
GO:0009897	0.382	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]