StarFunc result for job id Q02535

User Input

>input (119 residues)
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41133	0.900	0.900	3.628E-17	119	0.966	0.966	P41133.pdb.gz	ID3_MOUSE DNA-binding protein inhibitor ID-3 OS=Mus musculus OX=10090 GN=Id3 PE=1 SV=1
2	AFDB:Q90X14	0.469	0.449	1.794E-7	125	0.664	0.632	Q90X14.pdb.gz	Q90X14_CHICK Helix-loop-helix protein OS=Gallus gallus OX=9031 GN=Id3 PE=2 SV=1
3	AFDB:Q91399	0.409	0.412	1.794E-7	118	0.521	0.525	Q91399.pdb.gz	ID3A_XENLA DNA-binding protein inhibitor ID-3-A OS=Xenopus laevis OX=8355 GN=id3-a PE=1 SV=1
4	AFDB:Q8QFX4	0.400	0.409	2.359E-5	116	0.454	0.466	Q8QFX4.pdb.gz	Q8QFX4_DANRE DNA-binding protein inhibitor ID-3 OS=Danio rerio OX=7955 GN=ik:tdsubc_2g3 PE=2 SV=1
5	AFDB:P41139	0.371	0.277	5.624E-5	161	0.370	0.273	P41139.pdb.gz	ID4_MOUSE DNA-binding protein inhibitor ID-4 OS=Mus musculus OX=10090 GN=Id4 PE=1 SV=1
6	AFDB:Q9PWJ5	0.364	0.327	2.616E-4	133	0.345	0.308	Q9PWJ5.pdb.gz	ID2A_XENLA DNA-binding protein inhibitor ID-2-A OS=Xenopus laevis OX=8355 GN=id2-a PE=2 SV=1
7	AFDB:Q7SZQ2	0.381	0.333	2.990E-4	137	0.370	0.321	Q7SZQ2.pdb.gz	Q7SZQ2_DANRE DNA-binding protein inhibitor ID-2 OS=Danio rerio OX=7955 GN=id2 PE=2 SV=1
8	AFDB:O42361	0.352	0.328	3.906E-4	128	0.328	0.305	O42361.pdb.gz
9	AFDB:Q32PN8	0.411	0.389	4.465E-4	126	0.412	0.389	Q32PN8.pdb.gz	Q32PN8_DANRE DNA-binding protein inhibitor ID-4 OS=Danio rerio OX=7955 GN=zgc:123214 PE=2 SV=1
10	AFDB:Q7ZXF3	0.410	0.377	8.148E-4	131	0.336	0.305	Q7ZXF3.pdb.gz	ID4_XENLA DNA-binding protein inhibitor ID-4 OS=Xenopus laevis OX=8355 GN=id4 PE=2 SV=1
11	PDB:3ojaA	0.304	0.085	1.796	482	0.076	0.019	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
12	PDB:4v6xCr	0.202	0.181	4.281	137	0.042	0.036	4v6xCr.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:7v9mA	0.128	0.099	4.577	224	0.092	0.049	7v9mA.pdb.gz	Constitutive signal bias mediated by the human GHRHR splice variant 1.
14	PDB:6pxvA	0.209	0.032	5.593	823	0.067	0.010	6pxvA.pdb.gz
15	PDB:7edxH	0.162	0.111	5.593	209	0.134	0.077	7edxH.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
16	PDB:7p2e8	0.156	0.104	5.593	191	0.084	0.052	7p2e8.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
17	PDB:5mpsR	0.224	0.244	5.979	108	0.101	0.111	5mpsR.pdb.gz	Structure of a spliceosome remodelled for exon ligation.
18	PDB:7lbmd	0.199	0.094	5.979	275	0.143	0.062	7lbmd.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
19	PDB:2y42D	0.244	0.092	6.834	355	0.034	0.011	2y42D.pdb.gz	Atomic Level Description of the Domain Closure in a Dimeric Enzyme: Thermus Thermophilus 3-Isopropylmalate Dehydrogenase.
20	PDB:4c6gB	0.189	0.045	6.834	626	0.084	0.016	4c6gB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q02535	2.10e-83	241	119	1.000	1.000	ID3_HUMAN DNA-binding protein inhibitor ID-3 OS=Homo sapiens OX=9606 GN=ID3 PE=1 SV=2
2	P41138	2.02e-81	236	119	0.975	0.975	ID3_RAT DNA-binding protein inhibitor ID-3 OS=Rattus norvegicus OX=10116 GN=Id3 PE=1 SV=1
3	P41133	7.54e-81	234	119	0.966	0.966	ID3_MOUSE DNA-binding protein inhibitor ID-3 OS=Mus musculus OX=10090 GN=Id3 PE=1 SV=1
4	Q90X14	2.18e-45	145	125	0.664	0.632	Q90X14_CHICK Helix-loop-helix protein OS=Gallus gallus OX=9031 GN=Id3 PE=2 SV=1
5	Q91399	1.98e-39	129	118	0.588	0.593	ID3A_XENLA DNA-binding protein inhibitor ID-3-A OS=Xenopus laevis OX=8355 GN=id3-a PE=1 SV=1
6	Q8QFX4	8.84e-29	102	116	0.504	0.517	Q8QFX4_DANRE DNA-binding protein inhibitor ID-3 OS=Danio rerio OX=7955 GN=ik:tdsubc_2g3 PE=2 SV=1
7	Q02363	2.14e-23	89.7	134	0.454	0.403	ID2_HUMAN DNA-binding protein inhibitor ID-2 OS=Homo sapiens OX=9606 GN=ID2 PE=1 SV=1
8	Q9PWJ5	4.45e-23	89.0	133	0.403	0.361	ID2A_XENLA DNA-binding protein inhibitor ID-2-A OS=Xenopus laevis OX=8355 GN=id2-a PE=2 SV=1
9	Q7SZQ2	8.98e-23	88.2	137	0.345	0.299	Q7SZQ2_DANRE DNA-binding protein inhibitor ID-2 OS=Danio rerio OX=7955 GN=id2 PE=2 SV=1
10	P41136	1.34e-22	87.4	134	0.445	0.396	ID2_MOUSE DNA-binding protein inhibitor ID-2 OS=Mus musculus OX=10090 GN=Id2 PE=1 SV=3
11	P41137	1.94e-22	87.0	134	0.445	0.396	ID2_RAT DNA-binding protein inhibitor ID-2 OS=Rattus norvegicus OX=10116 GN=Id2 PE=1 SV=1
12	O73933	8.02e-22	85.5	134	0.378	0.336	O73933_CHICK Id2 OS=Gallus gallus OX=9031 GN=ID2 PE=2 SV=1
13	Q3LSV1	1.87e-21	84.7	134	0.370	0.328	Q3LSV1_COTJA Id2 OS=Coturnix japonica OX=93934 GN=Id2 PE=2 SV=1
14	P41134	2.23e-20	82.4	155	0.454	0.348	ID1_HUMAN DNA-binding protein inhibitor ID-1 OS=Homo sapiens OX=9606 GN=ID1 PE=1 SV=3
15	Q7ZXF3	1.47e-19	79.7	131	0.420	0.382	ID4_XENLA DNA-binding protein inhibitor ID-4 OS=Xenopus laevis OX=8355 GN=id4 PE=2 SV=1
16	Q6IQW5	7.71e-19	77.8	128	0.395	0.367	Q6IQW5_DANRE DNA-binding protein inhibitor ID-1 OS=Danio rerio OX=7955 GN=cb108 PE=1 SV=1
17	P20067	3.55e-17	74.7	168	0.412	0.292	ID1_MOUSE DNA-binding protein inhibitor ID-1 OS=Mus musculus OX=10090 GN=Id1 PE=1 SV=3
18	P41135	2.77e-16	72.0	164	0.403	0.293	ID1_RAT DNA-binding protein inhibitor ID-1 OS=Rattus norvegicus OX=10116 GN=Id1 PE=1 SV=1
19	Q32PN8	1.86e-14	66.6	126	0.387	0.365	Q32PN8_DANRE DNA-binding protein inhibitor ID-4 OS=Danio rerio OX=7955 GN=zgc:123214 PE=2 SV=1
20	P47928	7.59e-13	63.2	161	0.261	0.193	ID4_HUMAN DNA-binding protein inhibitor ID-4 OS=Homo sapiens OX=9606 GN=ID4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	1.5e-07	42.6	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363689

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262965	0.980	Transcription factor E2-alpha
2	9606.ENSP00000365280	0.940	DNA-binding protein inhibitor ID-1
3	9606.ENSP00000264824	0.918	Protein lyl-1
4	9606.ENSP00000263253	0.917	Histone acetyltransferase p300
5	9606.ENSP00000381382	0.912	Transcription factor 4
6	9606.ENSP00000387699	0.911	Cyclic AMP-responsive element-binding protein 1
7	9606.ENSP00000388940	0.883	Transcription factor 12
8	9606.ENSP00000263805	0.796	Zinc finger protein 106
9	9606.ENSP00000350844	0.750	Paired box protein Pax-5
10	9606.ENSP00000289749	0.720	Neuroblastoma suppressor of tumorigenicity 1
11	9606.ENSP00000338272	0.690	Hairy/enhancer-of-split related with YRPW motif protein 1
12	9606.ENSP00000411096	0.649	ATP binding cassette subfamily A member 13
13	9606.ENSP00000296468	0.647	Major facilitator superfamily domain-containing protein 8
14	9606.ENSP00000351539	0.642	Zinc finger and BTB domain-containing protein 18
15	9606.ENSP00000250003	0.641	Myoblast determination protein 1
16	9606.ENSP00000357156	0.627	CD5 antigen-like
17	9606.ENSP00000462521	0.589	Thioredoxin-interacting protein
18	9606.ENSP00000329127	0.574	Protein kinase C eta type
19	9606.ENSP00000362981	0.569	Homeobox protein TGIF2
20	9606.ENSP00000358092	0.561	PR domain zinc finger protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140416	1.000	transcription regulator inhibitor activity
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0097159	0.998	organic cyclic compound binding
GO:1901363	0.997	heterocyclic compound binding
GO:0043425	0.993	bHLH transcription factor binding
GO:0019904	0.983	protein domain specific binding
GO:0003676	0.692	nucleic acid binding
GO:0003677	0.666	DNA binding
GO:0043167	0.555	ion binding
GO:0043565	0.544	sequence-specific DNA binding
GO:0005504	0.527	fatty acid binding
GO:0140110	0.523	transcription regulator activity
GO:0003690	0.477	double-stranded DNA binding
GO:1990837	0.466	sequence-specific double-stranded DNA binding
GO:0003700	0.461	DNA-binding transcription factor activity
GO:0000976	0.434	transcription cis-regulatory region binding
GO:0000981	0.393	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.335	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:1901707	0.300	leptomycin B binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.998	regulation of macromolecule metabolic process
GO:0019219	0.997	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.992	negative regulation of cellular process
GO:0010468	0.990	regulation of gene expression
GO:0009987	0.978	cellular process
GO:0006355	0.978	regulation of DNA-templated transcription
GO:0048518	0.972	positive regulation of biological process
GO:0032502	0.947	developmental process
GO:0006357	0.929	regulation of transcription by RNA polymerase II
GO:0009892	0.918	negative regulation of metabolic process
GO:0048856	0.894	anatomical structure development
GO:0045892	0.875	negative regulation of DNA-templated transcription
GO:0050896	0.874	response to stimulus
GO:0032501	0.854	multicellular organismal process
GO:0048522	0.831	positive regulation of cellular process
GO:0007275	0.812	multicellular organism development
GO:0048869	0.806	cellular developmental process
GO:0030154	0.801	cell differentiation
GO:0000122	0.793	negative regulation of transcription by RNA polymerase II
GO:0009893	0.784	positive regulation of metabolic process
GO:0048731	0.678	system development
GO:0010604	0.659	positive regulation of macromolecule metabolic process
GO:0050793	0.619	regulation of developmental process
GO:0045595	0.602	regulation of cell differentiation
GO:0051716	0.531	cellular response to stimulus
GO:0031325	0.416	positive regulation of cellular metabolic process
GO:0051173	0.401	positive regulation of nitrogen compound metabolic process
GO:0045935	0.357	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.306	positive regulation of RNA metabolic process
GO:0048513	0.301	animal organ development
GO:0031328	0.300	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.991	nucleoplasm
GO:0005737	0.845	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]