StarFunc result for job id Q02548

User Input

>input (391 residues)
MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLA
ERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYS
ISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRV
FERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYP
IVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRF
PNPGLLGSPYYYSAAARGAAPPAAATAYDRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02548	1.000	1.000	1.375E-56	391	1.000	1.000	Q02548.pdb.gz	PAX5_HUMAN Paired box protein Pax-5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
2	AFDB:F1QGF8	0.475	0.469	1.331E-40	396	0.752	0.742	F1QGF8.pdb.gz	F1QGF8_DANRE Paired box 5 OS=Danio rerio OX=7955 GN=Pax[Zf-b] PE=4 SV=1
3	AFDB:Q02962	0.438	0.413	2.240E-40	417	0.721	0.676	Q02962.pdb.gz	PAX2_HUMAN Paired box protein Pax-2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=4
4	AFDB:F1R139	0.517	0.523	3.818E-39	386	0.678	0.687	F1R139.pdb.gz
5	AFDB:E7EQT0	0.427	0.499	4.599E-38	324	0.693	0.836	E7EQT0.pdb.gz	E7EQT0_HUMAN Paired box 5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
6	AFDB:Q5SZP1	0.381	0.366	5.797E-38	409	0.680	0.650	Q5SZP1.pdb.gz	Q5SZP1_HUMAN Paired box 2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=2
7	AFDB:O57682	0.464	0.374	3.331E-36	494	0.693	0.549	O57682.pdb.gz	PAX2B_XENLA Paired box protein Pax-2-B OS=Xenopus laevis OX=8355 GN=pax2-b PE=2 SV=2
8	AFDB:P51974	0.410	0.357	5.078E-30	457	0.601	0.514	P51974.pdb.gz	PAX8_RAT Paired box protein Pax-8 OS=Rattus norvegicus OX=10116 GN=Pax8 PE=1 SV=2
9	AFDB:F1Q9Q9	0.418	0.370	1.017E-29	448	0.570	0.498	F1Q9Q9.pdb.gz	F1Q9Q9_DANRE Paired box 8 OS=Danio rerio OX=7955 GN=pax8 PE=4 SV=2
10	AFDB:W0S3W1	0.354	0.307	2.754E-28	458	0.570	0.487	W0S3W1.pdb.gz	W0S3W1_ONCMY Transcription factor Pax8a OS=Oncorhynchus mykiss OX=8022 GN=Pax8a PE=2 SV=1
11	PDB:1c0wD	0.093	0.188	1.482E-1	175	0.046	0.103	1c0wD.pdb.gz	Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
12	PDB:4v6wAN	0.095	0.209	1.482E-1	150	0.072	0.187	4v6wAN.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:7a1gY	0.100	0.235	1.482E-1	150	0.064	0.167	7a1gY.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
14	PDB:1c0wB	0.092	0.155	2.355E-1	219	0.049	0.087	1c0wB.pdb.gz	Crystal structure of a cobalt-activated diphtheria toxin repressor-DNA complex reveals a metal-binding SH3-like domain.
15	PDB:5lzbz	0.102	0.070	2.802E-1	614	0.043	0.028	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
16	PDB:7pzyO	0.104	0.235	2.802E-1	150	0.069	0.180	7pzyO.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
17	PDB:2gqqC	0.105	0.239	3.145E-1	157	0.038	0.096	2gqqC.pdb.gz
18	PDB:2cg4A	0.108	0.263	3.333E-1	149	0.041	0.107	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
19	PDB:3j7aU	0.110	0.244	3.965E-1	149	0.066	0.174	3j7aU.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
20	PDB:2h09A	0.095	0.262	4.201E-1	127	0.054	0.165	2h09A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRH7	0.0	526	393	0.714	0.710	A0A0A0MRH7_HUMAN Paired box 2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=1
2	A0A0G2JZ47	0.0	526	394	0.714	0.708	A0A0G2JZ47_RAT Paired box 2 OS=Rattus norvegicus OX=10116 GN=Pax2 PE=4 SV=2
3	E7EQT0	0.0	530	324	0.665	0.802	E7EQT0_HUMAN Paired box 5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
4	E7ERK2	0.0	575	283	0.724	1.000	E7ERK2_HUMAN Paired box 5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
5	E7ERW5	0.0	531	295	0.665	0.881	E7ERW5_HUMAN Paired box 5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
6	F1QGF8	0.0	559	396	0.747	0.737	F1QGF8_DANRE Paired box 5 OS=Danio rerio OX=7955 GN=Pax[Zf-b] PE=4 SV=1
7	P32114	0.0	522	414	0.703	0.664	PAX2_MOUSE Paired box protein Pax-2 OS=Mus musculus OX=10090 GN=Pax2 PE=1 SV=2
8	Q02548	0.0	798	391	1.000	1.000	PAX5_HUMAN Paired box protein Pax-5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
9	Q02650	0.0	790	391	0.992	0.992	PAX5_MOUSE Paired box protein Pax-5 OS=Mus musculus OX=10090 GN=Pax5 PE=1 SV=1
10	Q02962	0.0	513	417	0.716	0.671	PAX2_HUMAN Paired box protein Pax-2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=4
11	Q90268	0.0	529	410	0.706	0.673	PAX2A_DANRE Paired box protein Pax-2a OS=Danio rerio OX=7955 GN=pax2a PE=2 SV=2
12	Q9PTX1	0.0	553	394	0.716	0.711	Q9PTX1_CHICK Paired-box containing protein Pax-2 OS=Gallus gallus OX=9031 GN=Pax-2 PE=2 SV=1
13	D4ACZ2	1.14e-180	510	416	0.711	0.668	D4ACZ2_RAT Paired box 2 OS=Rattus norvegicus OX=10116 GN=Pax2 PE=4 SV=1
14	Q5SZP1	5.57e-179	505	409	0.660	0.631	Q5SZP1_HUMAN Paired box 2 OS=Homo sapiens OX=9606 GN=PAX2 PE=1 SV=2
15	O93370	6.20e-178	502	386	0.683	0.692	O93370_DANRE Paired box 2b OS=Danio rerio OX=7955 GN=Pax2.2 PE=2 SV=1
16	E7ES87	1.35e-139	398	220	0.501	0.891	E7ES87_HUMAN Paired box 5 OS=Homo sapiens OX=9606 GN=PAX5 PE=1 SV=1
17	Q00288	9.95e-137	400	457	0.606	0.519	PAX8_MOUSE Paired box protein Pax-8 OS=Mus musculus OX=10090 GN=Pax8 PE=1 SV=3
18	Q06710	1.07e-135	397	450	0.598	0.520	PAX8_HUMAN Paired box protein Pax-8 OS=Homo sapiens OX=9606 GN=PAX8 PE=1 SV=2
19	R9W7C9	1.07e-135	397	450	0.598	0.520	R9W7C9_HUMAN Paired box 8 isoform 1 OS=Homo sapiens OX=9606 GN=PAX8 PE=2 SV=1
20	O57682	9.51e-134	394	494	0.527	0.417	PAX2B_XENLA Paired box protein Pax-2-B OS=Xenopus laevis OX=8355 GN=pax2-b PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	5.4e+02	11.9	Homeodomain
2	PF13384 HTH_23	0.015	26.4	Homeodomain-like domain
3	PF13518 HTH_28	2.5e+02	13.2	Helix-turn-helix domain
4	PF13565 HTH_32	0.004	29.1	Homeodomain-like domain
5	PF13936 HTH_38	3.6e+02	12.4	Helix-turn-helix domain
6	PF12759 HTH_Tnp_IS1	2.5e+02	12.7	InsA C-terminal domain
7	PF00292 PAX	9e-72	250.3	'Paired box' domain
8	PF12403 Pax2_C	2.4e-48	174.2	Paired-box protein 2 C terminal
9	PF08069 Ribosomal_S13_N	4.6e+02	12.3	Ribosomal S13/S15 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003940099.1

Rank	PPI partner	STRING score	Description
1	27679.XP_003923567.1	0.948	Protein C-ets-1
2	27679.XP_010341344.1	0.840	Transcriptional activator Myb
3	27679.XP_003929516.1	0.771	Lymphoid enhancer-binding factor 1 isoform X1
4	27679.XP_010349021.1	0.754	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 212 ESTs, 8 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	27679.XP_010327881.1	0.749	PAX-interacting protein 1
6	27679.XP_010330758.1	0.719	Transcription factor E2-alpha isoform X1
7	27679.XP_003927795.1	0.691	Runt-related transcription factor 1
8	27679.XP_010336567.1	0.689	Transcription factor
9	27679.XP_003943262.1	0.656	B-cell antigen receptor complex-associated protein alpha chain
10	27679.XP_003933874.1	0.654	Belongs to the Toll-like receptor family.
11	27679.XP_010339693.1	0.652	DNA-binding protein Ikaros
12	27679.XP_010329165.1	0.651	Binds the poly(A) tail of mRNA.
13	27679.XP_010340808.1	0.651	THO complex subunit 4
14	27679.XP_010336403.1	0.643	Interferon regulatory factor 4 isoform X1
15	27679.XP_003927052.1	0.641	B-cell lymphoma 6 protein
16	27679.XP_003942939.1	0.637	Myb-related protein A isoform X1
17	27679.XP_010344739.1	0.636	PR domain zinc finger protein 1 isoform X1
18	27679.XP_010344058.1	0.628	Syndecan-1
19	27679.XP_003944228.1	0.616	Tyrosine-protein kinase Blk
20	27679.XP_010343736.1	0.606	Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'- TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	0.997	DNA-binding transcription factor activity
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0000987	0.979	cis-regulatory region sequence-specific DNA binding
GO:0000981	0.927	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0060090	0.808	molecular adaptor activity
GO:0000977	0.716	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.992	developmental process
GO:0009987	0.992	cellular process
GO:0050794	0.965	regulation of cellular process
GO:0048856	0.957	anatomical structure development
GO:0032501	0.944	multicellular organismal process
GO:0019222	0.891	regulation of metabolic process
GO:0048518	0.889	positive regulation of biological process
GO:0060255	0.877	regulation of macromolecule metabolic process
GO:0050896	0.871	response to stimulus
GO:0048522	0.865	positive regulation of cellular process
GO:0031323	0.863	regulation of cellular metabolic process
GO:0080090	0.858	regulation of primary metabolic process
GO:0051171	0.856	regulation of nitrogen compound metabolic process
GO:0010468	0.846	regulation of gene expression
GO:0007275	0.806	multicellular organism development
GO:0019219	0.701	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.699	regulation of biosynthetic process
GO:0051252	0.693	regulation of RNA metabolic process
GO:0009893	0.690	positive regulation of metabolic process
GO:0010556	0.688	regulation of macromolecule biosynthetic process
GO:0031326	0.685	regulation of cellular biosynthetic process
GO:2001141	0.674	regulation of RNA biosynthetic process
GO:0006355	0.661	regulation of DNA-templated transcription
GO:0048731	0.636	system development
GO:0010604	0.635	positive regulation of macromolecule metabolic process
GO:0048519	0.613	negative regulation of biological process
GO:0051173	0.567	positive regulation of nitrogen compound metabolic process
GO:0030154	0.560	cell differentiation
GO:0031325	0.534	positive regulation of cellular metabolic process
GO:0008152	0.521	metabolic process
GO:0048523	0.501	negative regulation of cellular process
GO:0044237	0.437	cellular metabolic process
GO:0071704	0.434	organic substance metabolic process
GO:0006357	0.430	regulation of transcription by RNA polymerase II
GO:0044238	0.427	primary metabolic process
GO:0007399	0.425	nervous system development
GO:0051716	0.421	cellular response to stimulus
GO:0045935	0.405	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.402	positive regulation of DNA-templated transcription
GO:0009892	0.399	negative regulation of metabolic process
GO:0006807	0.388	nitrogen compound metabolic process
GO:0010605	0.387	negative regulation of macromolecule metabolic process
GO:0009888	0.384	tissue development
GO:0009653	0.371	anatomical structure morphogenesis
GO:0048513	0.365	animal organ development
GO:0045944	0.361	positive regulation of transcription by RNA polymerase II
GO:0051172	0.355	negative regulation of nitrogen compound metabolic process
GO:0031324	0.338	negative regulation of cellular metabolic process
GO:0002376	0.336	immune system process
GO:0043170	0.332	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.771	intracellular non-membrane-bounded organelle
GO:0005737	0.715	cytoplasm
GO:0032991	0.684	protein-containing complex
GO:0005829	0.636	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]