StarFunc result for job id Q02556

User Input

>input (426 residues)
MCDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAW
AVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKC
KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQ
QPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTK
LYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCS
GNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPL
RSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRE
NQQITV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02556	1.000	1.000	9.141E-87	426	1.000	1.000	Q02556.pdb.gz	IRF8_HUMAN Interferon regulatory factor 8 OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=2
2	AFDB:Q5NUI4	0.939	0.943	2.433E-75	424	0.885	0.889	Q5NUI4.pdb.gz
3	AFDB:Q6DHK7	0.640	0.645	3.362E-50	423	0.533	0.537	Q6DHK7.pdb.gz	Q6DHK7_DANRE Interferon regulatory factor 8 OS=Danio rerio OX=7955 GN=zgc:92252 PE=2 SV=1
4	AFDB:Q15306	0.604	0.573	1.901E-40	451	0.437	0.412	Q15306.pdb.gz	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
5	AFDB:A8B8L1	0.392	0.365	9.990E-40	460	0.420	0.389	A8B8L1.pdb.gz
6	AFDB:B5X4X0	0.391	0.388	3.968E-37	430	0.359	0.356	B5X4X0.pdb.gz	B5X4X0_SALSA Interferon regulatory factor 9 OS=Salmo salar OX=8030 GN=IRF9 PE=2 SV=1
7	AFDB:Q61179	0.343	0.364	4.857E-34	399	0.324	0.346	Q61179.pdb.gz	IRF9_MOUSE Interferon regulatory factor 9 OS=Mus musculus OX=10090 GN=Irf9 PE=1 SV=1
8	AFDB:A0A0G2JUR2	0.417	0.377	8.348E-33	475	0.336	0.301	A0A0G2JUR2.pdb.gz	A0A0G2JUR2_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=2
9	AFDB:Q13568	0.395	0.339	5.559E-32	498	0.333	0.285	Q13568.pdb.gz	IRF5_HUMAN Interferon regulatory factor 5 OS=Homo sapiens OX=9606 GN=IRF5 PE=1 SV=2
10	AFDB:G0Z349	0.416	0.383	1.067E-31	467	0.312	0.285	G0Z349.pdb.gz	G0Z349_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=4 SV=1
11	PDB:7dvqX	0.202	0.490	3.660E-2	156	0.033	0.090	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:1u0rD	0.133	0.182	5.266E-1	301	0.049	0.070	1u0rD.pdb.gz
13	PDB:5z56X	0.168	0.383	7.514E-1	159	0.033	0.088	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
14	PDB:7e2cI	0.107	0.063	7.514E-1	799	0.028	0.015	7e2cI.pdb.gz
15	PDB:6hd5u	0.065	0.104	8.459E-1	235	0.040	0.072	6hd5u.pdb.gz
16	PDB:2abjA	0.085	0.096	1.072	366	0.040	0.046	2abjA.pdb.gz	The design and synthesis of human branched-chain amino acid aminotransferase inhibitors for treatment of neurodegenerative diseases.
17	PDB:5zr1B	0.137	0.152	1.072	374	0.026	0.029	5zr1B.pdb.gz	Structure of the origin recognition complex bound to DNA replication origin.
18	PDB:6zqdUN	0.059	0.102	1.072	203	0.061	0.128	6zqdUN.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
19	PDB:5ijdC	0.090	0.176	1.207	137	0.054	0.168	5ijdC.pdb.gz	TLR4/MD-2 activation by a synthetic agonist with no similarity to LPS.
20	PDB:2qbyB	0.098	0.110	1.281	368	0.023	0.027	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AJP7	0.0	789	466	0.885	0.809	A0A8I6AJP7_RAT Interferon regulatory factor 8 OS=Rattus norvegicus OX=10116 GN=Irf8 PE=4 SV=1
2	H3BT31	0.0	684	328	0.770	1.000	H3BT31_HUMAN Interferon regulatory factor 8 (Fragment) OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=1
3	P23611	0.0	794	424	0.897	0.901	IRF8_MOUSE Interferon regulatory factor 8 OS=Mus musculus OX=10090 GN=Irf8 PE=1 SV=1
4	Q02556	0.0	883	426	1.000	1.000	IRF8_HUMAN Interferon regulatory factor 8 OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=2
5	A0A8I5Y754	1.77e-175	495	333	0.561	0.718	A0A8I5Y754_RAT Interferon regulatory factor 8 OS=Rattus norvegicus OX=10116 GN=Irf8 PE=4 SV=1
6	H3BRT4	1.07e-161	456	222	0.521	1.000	H3BRT4_HUMAN Interferon regulatory factor 8 OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=2
7	Q6DHK7	1.43e-153	443	423	0.556	0.560	Q6DHK7_DANRE Interferon regulatory factor 8 OS=Danio rerio OX=7955 GN=zgc:92252 PE=2 SV=1
8	Q15306	1.08e-98	304	451	0.432	0.408	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
9	Q64287	6.54e-98	302	450	0.432	0.409	IRF4_MOUSE Interferon regulatory factor 4 OS=Mus musculus OX=10090 GN=Irf4 PE=1 SV=1
10	Q61179	7.34e-68	223	399	0.326	0.348	IRF9_MOUSE Interferon regulatory factor 9 OS=Mus musculus OX=10090 GN=Irf9 PE=1 SV=1
11	D3ZPU1	6.50e-63	213	497	0.343	0.294	D3ZPU1_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=1
12	P56477	2.09e-62	211	497	0.347	0.298	IRF5_MOUSE Interferon regulatory factor 5 OS=Mus musculus OX=10090 GN=Irf5 PE=1 SV=1
13	H0YNP4	5.92e-62	207	402	0.315	0.333	H0YNP4_HUMAN Interferon regulatory factor 9 OS=Homo sapiens OX=9606 GN=IRF9 PE=1 SV=2
14	Q00978	1.27e-61	206	393	0.298	0.323	IRF9_HUMAN Interferon regulatory factor 9 OS=Homo sapiens OX=9606 GN=IRF9 PE=1 SV=1
15	A0A8I5YBA0	1.06e-60	207	536	0.340	0.271	A0A8I5YBA0_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=1
16	A0A0G2JUR2	1.07e-60	207	528	0.340	0.275	A0A0G2JUR2_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=2
17	P97431	1.46e-57	197	467	0.322	0.293	IRF6_MOUSE Interferon regulatory factor 6 OS=Mus musculus OX=10090 GN=Irf6 PE=1 SV=2
18	G0Z349	4.84e-57	196	467	0.326	0.298	G0Z349_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=4 SV=1
19	O14896	4.84e-57	196	467	0.326	0.298	IRF6_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=1 SV=1
20	B5X4X0	7.98e-50	176	430	0.178	0.177	B5X4X0_SALSA Interferon regulatory factor 9 OS=Salmo salar OX=8030 GN=IRF9 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00605 IRF	3.9e-39	144.5	Interferon regulatory factor transcription factor
2	PF10401 IRF-3	1e-61	219.3	Interferon-regulatory factor 3
3	PF03166 MH2	2.1	20.1	MH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268638

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227163	0.999	Transcription factor PU.1
2	9606.ENSP00000354394	0.979	Signal transducer and activator of transcription 1-alpha/beta
3	9606.ENSP00000368699	0.954	Ubiquitin-like protein ISG15
4	9606.ENSP00000315768	0.951	Signal transducer and activator of transcription 2
5	9606.ENSP00000381601	0.948	Interferon-induced GTP-binding protein Mx1
6	9606.ENSP00000360869	0.944	Interferon-induced protein with tetratricopeptide repeats 1
7	9606.ENSP00000364885	0.944	Zinc finger and BTB domain-containing protein 17
8	9606.ENSP00000359497	0.943	Guanylate-binding protein 2
9	9606.ENSP00000371471	0.939	Radical S-adenosyl methionine domain-containing protein 2
10	9606.ENSP00000342278	0.938	2'-5'-oligoadenylate synthase 2
11	9606.ENSP00000360883	0.938	Interferon-induced protein with tetratricopeptide repeats 3
12	9606.ENSP00000252593	0.937	Bone marrow stromal antigen 2
13	9606.ENSP00000479618	0.935	Myc proto-oncogene protein
14	9606.ENSP00000360891	0.934	Interferon-induced protein with tetratricopeptide repeats 2
15	9606.ENSP00000306565	0.932	Interferon-stimulated gene 20 kDa protein
16	9606.ENSP00000395590	0.932	Interferon-induced 35 kDa protein
17	9606.ENSP00000239938	0.931	Early growth response protein 1
18	9606.ENSP00000388001	0.931	2'-5'-oligoadenylate synthase 1
19	9606.ENSP00000257570	0.930	2'-5'-oligoadenylate synthase-like protein
20	9606.ENSP00000364016	0.930	Proteasome subunit beta type-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0003700	0.998	DNA-binding transcription factor activity
GO:0000976	0.994	transcription cis-regulatory region binding
GO:0000977	0.913	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001217	0.895	DNA-binding transcription repressor activity
GO:0000981	0.864	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.857	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227	0.431	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.987	response to stimulus
GO:0050794	0.987	regulation of cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0009987	0.982	cellular process
GO:0010468	0.979	regulation of gene expression
GO:0048519	0.972	negative regulation of biological process
GO:0009607	0.965	response to biotic stimulus
GO:0048522	0.965	positive regulation of cellular process
GO:0010556	0.965	regulation of macromolecule biosynthetic process
GO:0031326	0.965	regulation of cellular biosynthetic process
GO:0051252	0.965	regulation of RNA metabolic process
GO:0002376	0.961	immune system process
GO:0045944	0.961	positive regulation of transcription by RNA polymerase II
GO:0048523	0.949	negative regulation of cellular process
GO:0006950	0.932	response to stress
GO:0051716	0.932	cellular response to stimulus
GO:0009605	0.929	response to external stimulus
GO:0006955	0.927	immune response
GO:0006952	0.923	defense response
GO:0044419	0.922	biological process involved in interspecies interaction between organisms
GO:0043207	0.916	response to external biotic stimulus
GO:0051707	0.909	response to other organism
GO:0042221	0.883	response to chemical
GO:0098542	0.860	defense response to other organism
GO:0010033	0.859	response to organic substance
GO:0070887	0.830	cellular response to chemical stimulus
GO:0010605	0.822	negative regulation of macromolecule metabolic process
GO:0071310	0.818	cellular response to organic substance
GO:0051239	0.722	regulation of multicellular organismal process
GO:0034097	0.674	response to cytokine
GO:0045087	0.642	innate immune response
GO:0051172	0.513	negative regulation of nitrogen compound metabolic process
GO:0031324	0.476	negative regulation of cellular metabolic process
GO:0032502	0.398	developmental process
GO:0071345	0.381	cellular response to cytokine stimulus
GO:0051240	0.362	positive regulation of multicellular organismal process
GO:1902679	0.342	negative regulation of RNA biosynthetic process
GO:0048856	0.323	anatomical structure development
GO:0001817	0.313	regulation of cytokine production
GO:0007154	0.306	cell communication
GO:0023052	0.305	signaling
GO:0007165	0.304	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005829	0.987	cytosol
GO:0016020	0.623	membrane
GO:0071944	0.521	cell periphery
GO:0005886	0.497	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]