StarFunc result for job id Q02575

User Input

>input (133 residues)
MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH
LSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLA
ICYISYLNHVLDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q02575	1.000	1.000	4.224E-20	133	1.000	1.000	Q02575.pdb.gz	HEN1_HUMAN Helix-loop-helix protein 1 OS=Homo sapiens OX=9606 GN=NHLH1 PE=1 SV=1
2	AFDB:Q02577	0.562	0.554	3.397E-11	135	0.632	0.622	Q02577.pdb.gz	HEN2_HUMAN Helix-loop-helix protein 2 OS=Homo sapiens OX=9606 GN=NHLH2 PE=1 SV=1
3	AFDB:Q18590	0.531	0.792	3.626E-8	89	0.383	0.573	Q18590.pdb.gz	HLH15_CAEEL Helix-loop-helix protein 15 OS=Caenorhabditis elegans OX=6239 GN=hlh-15 PE=2 SV=1
4	AFDB:Q1LXV2	0.413	0.278	1.117E-5	199	0.346	0.231	Q1LXV2.pdb.gz
5	AFDB:Q12870	0.416	0.281	1.283E-5	199	0.368	0.246	Q12870.pdb.gz	TCF15_HUMAN Transcription factor 15 OS=Homo sapiens OX=9606 GN=TCF15 PE=2 SV=3
6	AFDB:P59101	0.404	0.294	1.691E-5	187	0.361	0.257	P59101.pdb.gz	SCX_CHICK Basic helix-loop-helix transcription factor scleraxis OS=Gallus gallus OX=9031 GN=SCX PE=2 SV=1
7	AFDB:O93507	0.448	0.187	4.148E-5	324	0.331	0.136	O93507.pdb.gz	TAL1_DANRE T-cell acute lymphocytic leukemia protein 1 homolog OS=Danio rerio OX=7955 GN=tal1 PE=1 SV=1
8	AFDB:E7F361	0.414	0.280	7.722E-5	200	0.346	0.230	E7F361.pdb.gz
9	AFDB:Q6XD76	0.469	0.368	1.018E-4	172	0.278	0.215	Q6XD76.pdb.gz	ASCL4_HUMAN Achaete-scute homolog 4 OS=Homo sapiens OX=9606 GN=ASCL4 PE=1 SV=1
10	AFDB:B5DFF0	0.403	0.244	1.091E-4	228	0.383	0.224	B5DFF0.pdb.gz	B5DFF0_RAT Scx protein OS=Rattus norvegicus OX=10116 GN=Scx PE=2 SV=1
11	PDB:7suk5	0.262	0.147	3.558	296	0.090	0.041	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
12	PDB:3ojaA	0.214	0.082	4.689	482	0.075	0.021	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
13	PDB:5ay8A	0.183	0.244	5.024	97	0.113	0.155	5ay8A.pdb.gz	Structure and function of human histone H3.Y nucleosome
14	PDB:4h9sA	0.224	0.307	8.146	89	0.113	0.169	4h9sA.pdb.gz
15	PDB:4jjnA	0.175	0.232	8.146	98	0.083	0.112	4jjnA.pdb.gz	Heterochromatin protein Sir3 induces contacts between the amino terminus of histone H4 and nucleosomal DNA.
16	PDB:4v8sAY	0.180	0.077	8.146	376	0.038	0.013	4v8sAY.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
17	PDB:7o37c	0.208	0.109	8.146	259	0.045	0.023	7o37c.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
18	PDB:7on1e	0.175	0.234	8.146	97	0.075	0.103	7on1e.pdb.gz	Cenp-A nucleosome in complex with Cenp-C
19	PDB:1kx5A	0.177	0.174	8.728	135	0.075	0.074	1kx5A.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
20	PDB:4v8mBk	0.217	0.338	8.728	84	0.083	0.131	4v8mBk.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q02575	1.77e-94	270	133	1.000	1.000	HEN1_HUMAN Helix-loop-helix protein 1 OS=Homo sapiens OX=9606 GN=NHLH1 PE=1 SV=1
2	Q5T203	1.77e-94	270	133	1.000	1.000	Q5T203_HUMAN Nescient helix loop helix 1 OS=Homo sapiens OX=9606 GN=NHLH1 PE=1 SV=1
3	Q64221	1.07e-34	119	135	0.699	0.689	HEN2_MOUSE Helix-loop-helix protein 2 OS=Mus musculus OX=10090 GN=Nhlh2 PE=1 SV=2
4	Q02577	8.33e-34	116	135	0.586	0.578	HEN2_HUMAN Helix-loop-helix protein 2 OS=Homo sapiens OX=9606 GN=NHLH2 PE=1 SV=1
5	Q18590	2.87e-26	96.3	89	0.383	0.573	HLH15_CAEEL Helix-loop-helix protein 15 OS=Caenorhabditis elegans OX=6239 GN=hlh-15 PE=2 SV=1
6	F1QUD8	2.56e-14	66.2	109	0.248	0.303	F1QUD8_DANRE T-cell acute lymphocytic leukemia 2 OS=Danio rerio OX=7955 GN=zgc:111884 PE=4 SV=1
7	Q62282	4.97e-14	65.5	108	0.248	0.306	TAL2_MOUSE T-cell acute lymphocytic leukemia protein 2 homolog OS=Mus musculus OX=10090 GN=Tal2 PE=4 SV=1
8	O73823	7.96e-14	68.9	394	0.256	0.086	TAL1_XENLA T-cell acute lymphocytic leukemia protein 1 OS=Xenopus laevis OX=8355 GN=tal1 PE=2 SV=1
9	O93507	1.01e-13	68.2	324	0.248	0.102	TAL1_DANRE T-cell acute lymphocytic leukemia protein 1 homolog OS=Danio rerio OX=7955 GN=tal1 PE=1 SV=1
10	Q16559	1.19e-13	64.3	108	0.248	0.306	TAL2_HUMAN T-cell acute lymphocytic leukemia protein 2 OS=Homo sapiens OX=9606 GN=TAL2 PE=1 SV=1
11	P17542	1.89e-13	67.4	331	0.248	0.100	TAL1_HUMAN T-cell acute lymphocytic leukemia protein 1 OS=Homo sapiens OX=9606 GN=TAL1 PE=1 SV=2
12	P22091	2.45e-13	67.0	329	0.248	0.100	TAL1_MOUSE T-cell acute lymphocytic leukemia protein 1 homolog OS=Mus musculus OX=10090 GN=Tal1 PE=1 SV=1
13	P12980	1.39e-12	64.7	280	0.241	0.114	LYL1_HUMAN Protein lyl-1 OS=Homo sapiens OX=9606 GN=LYL1 PE=1 SV=3
14	P57102	2.50e-12	63.2	208	0.233	0.149	HAND2_DANRE Heart- and neural crest derivatives-expressed protein 2 OS=Danio rerio OX=7955 GN=hand2 PE=2 SV=1
15	P27792	2.74e-12	63.9	278	0.248	0.119	LYL1_MOUSE Protein lyl-1 OS=Mus musculus OX=10090 GN=Lyl1 PE=2 SV=2
16	Q60756	2.98e-12	62.8	195	0.233	0.159	TCF15_MOUSE Transcription factor 15 OS=Mus musculus OX=10090 GN=Tcf15 PE=1 SV=2
17	P59101	3.53e-12	62.4	187	0.368	0.262	SCX_CHICK Basic helix-loop-helix transcription factor scleraxis OS=Gallus gallus OX=9031 GN=SCX PE=2 SV=1
18	Q498R2	4.62e-12	62.0	179	0.361	0.268	Q498R2_RAT Transcription factor 21 OS=Rattus norvegicus OX=10116 GN=Tcf21 PE=4 SV=1
19	O35437	4.92e-12	62.0	179	0.361	0.268	TCF21_MOUSE Transcription factor 21 OS=Mus musculus OX=10090 GN=Tcf21 PE=2 SV=1
20	Q64124	5.83e-12	62.0	207	0.256	0.164	SCX_MOUSE Basic helix-loop-helix transcription factor scleraxis OS=Mus musculus OX=10090 GN=Scx PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	2e-15	67.8	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 185453.XP_006861714.1

Rank	PPI partner	STRING score	Description
1	185453.XP_006831673.1	0.724	Transcription factor 12 isoform X1
2	185453.XP_006837565.1	0.724	Transcription factor 4-like isoform X1
3	185453.XP_006869136.1	0.712	Transcription factor E2-alpha
4	185453.XP_006874834.1	0.704	Cyclic nucleotide-gated olfactory channel
5	185453.XP_006832473.1	0.699	Hepatic leukemia factor
6	185453.XP_006873120.1	0.652	Protein max isoform X1
7	185453.XP_006871424.1	0.579	DNA repair protein XRCC1
8	185453.XP_006834236.1	0.575	LIM/homeobox protein Lhx9 isoform X1
9	185453.XP_006834997.1	0.547	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 7 Proteins
10	185453.XP_006831343.1	0.539	LIM domain-binding protein 1 isoform X1
11	185453.XP_006872544.1	0.539	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 11 Proteins
12	185453.XP_006873043.1	0.523	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
13	185453.XP_006839609.1	0.521	Homeobox protein goosecoid
14	185453.XP_006830862.1	0.516	Stathmin-2
15	185453.XP_006864249.1	0.504	Transgelin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001216	0.931	DNA-binding transcription activator activity
GO:0001228	0.913	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.512	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.997	regulation of macromolecule metabolic process
GO:0080090	0.996	regulation of primary metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0048522	0.995	positive regulation of cellular process
GO:0031326	0.994	regulation of cellular biosynthetic process
GO:0032501	0.990	multicellular organismal process
GO:0010468	0.989	regulation of gene expression
GO:0010556	0.987	regulation of macromolecule biosynthetic process
GO:0051252	0.987	regulation of RNA metabolic process
GO:0010604	0.983	positive regulation of macromolecule metabolic process
GO:0032502	0.982	developmental process
GO:0031325	0.977	positive regulation of cellular metabolic process
GO:0051173	0.976	positive regulation of nitrogen compound metabolic process
GO:0048856	0.973	anatomical structure development
GO:0045893	0.972	positive regulation of DNA-templated transcription
GO:0048731	0.961	system development
GO:0006357	0.947	regulation of transcription by RNA polymerase II
GO:0045944	0.864	positive regulation of transcription by RNA polymerase II
GO:0007399	0.680	nervous system development
GO:0009987	0.438	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031974	0.994	membrane-enclosed lumen
GO:0032991	0.991	protein-containing complex
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0043233	0.977	organelle lumen
GO:0005667	0.974	transcription regulator complex
GO:0031981	0.967	nuclear lumen
GO:0005654	0.963	nucleoplasm
GO:0005694	0.918	chromosome
GO:0000785	0.911	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]